Recombinant Full Length Saccharomyces Cerevisiae Ferric/Cupric Reductase Transmembrane Component 7(Fre7) Protein, His-Tagged
Cat.No. : | RFL32249SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Ferric/cupric reductase transmembrane component 7(FRE7) Protein (A6ZN61) (1-620aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-620) |
Form : | Lyophilized powder |
AA Sequence : | MIEERDLVLSNGIHCIADIHSELYARLKKESQAVTPWVYQKQYGKFVTYFVAVIIFLSLI KKLAFMYYDSSEEFLPEKKNSPTTPSVFLARIMTKLVAFNRYICYRKFPTLIFSYLGIPT SVGTFLVVMATTLYTLLYCFVPHPFYRPCAGFGSPPLSVRAGIMAISLVSFVFSLSGKIN VIGWLVGLSYEKINIYHQWASILCLFFSWVHVIPFLRQARHEGGYERMHQRWKASDMWRS GVPPILFLNLLWLSSLPIARRHFYEIFLQLHWILAVGFYISLFYHVYPELNSHMYLVATI VVWFAQLFYRLAVKGYLRPGRSFMASTIANVSIVGEGCVELIVKDVDMAYSPGQHIFVRT IDKDIISNHPFSIFPSAKYPGGIKMLIRAQKGFSKRLYESNDDMKKILIDGPYGGIERDI RSFTNVYLICSGSGISTCLPFLQKYGPILHKTNLEVITLDWVVRHREDISWIRDEICTLS NNLRQLFLDGTIVVRIYVCSDSTVPGIIKTFPQTADTASDQSDLAKREKDTEFGQDDTES NSTFDKSNNEYKGLITIIPSKPDLNQVINDYQIGFRNCFICSGSDSLRYTVGNSVAGLQA KVFSNKNVEECYLHSESFGY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FRE7 |
Synonyms | FRE7; SCY_4929; Ferric/cupric reductase transmembrane component 7; Ferric-chelate reductase 7 |
UniProt ID | A6ZN61 |
◆ Recombinant Proteins | ||
NT5DC2-3758R | Recombinant Rat NT5DC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGFR-61CAF555 | Recombinant Monkey EGFR Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
PVR-614H | Recombinant Human PVR protein, His-Avi-tagged | +Inquiry |
RMC1-6603H | Recombinant Human RMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MATN3-622H | Recombinant Human MATN3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
HP-75C | Native Canine Haptoglobin | +Inquiry |
Immunoglobulin A1-77H | Native Human Immunoglobulin A1 | +Inquiry |
TF-262H | Native Human Transferrin | +Inquiry |
ALB-313B | Native Bovine Albumin, Texas Red Label | +Inquiry |
GS-32 | Active Native Glutamine synthetase | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTO1-761HCL | Recombinant Human GSTO1 cell lysate | +Inquiry |
PPAPDC1A-2990HCL | Recombinant Human PPAPDC1A 293 Cell Lysate | +Inquiry |
APOO-8774HCL | Recombinant Human APOO 293 Cell Lysate | +Inquiry |
ABI2-9127HCL | Recombinant Human ABI2 293 Cell Lysate | +Inquiry |
ACAD11-9117HCL | Recombinant Human ACAD11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FRE7 Products
Required fields are marked with *
My Review for All FRE7 Products
Required fields are marked with *
0
Inquiry Basket