Recombinant Full Length Saccharomyces Cerevisiae Ergosterol Biosynthetic Protein 28(Erg28) Protein, His-Tagged
Cat.No. : | RFL36648SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Ergosterol biosynthetic protein 28(ERG28) Protein (P40030) (1-148aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-148) |
Form : | Lyophilized powder |
AA Sequence : | MFSLQDVITTTKTTLAAMPKGYLPKWLLFISIVSVFNSIQTYVSGLELTRKVYERKPTET THLSARTFGTWTFISCVIRFYGAMYLNEPHIFELVFMSYMVALFHFGSELLIFRTCKLGK GFMGPLVVSTTSLVWMYKQREYYTGVAW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG28 |
Synonyms | ERG28; BUD18; YER044C; Ergosterol biosynthetic protein 28 |
UniProt ID | P40030 |
◆ Recombinant Proteins | ||
CST2-3357H | Recombinant Human CST2 Protein, MYC/DDK-tagged | +Inquiry |
Mtor-25M | Recombinant Mouse Mtor protein, His-tagged | +Inquiry |
MPXV-0511 | Recombinant Monkeypox Virus F3L Protein | +Inquiry |
FKPA-2364E | Recombinant Escherichia coli O6:H1 FKPA Protein (26-270 aa), His-tagged | +Inquiry |
Tfpi2-1997R | Recombinant Rat Tfpi2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
AC-62H | Native Human Activated Protein C | +Inquiry |
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
KRT8-177B | Native bovine KRT8 | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF114-145HCL | Recombinant Human ZNF114 293 Cell Lysate | +Inquiry |
MMP19-4277HCL | Recombinant Human MMP19 293 Cell Lysate | +Inquiry |
RIC3-2341HCL | Recombinant Human RIC3 293 Cell Lysate | +Inquiry |
SNIP1-1628HCL | Recombinant Human SNIP1 293 Cell Lysate | +Inquiry |
CYP1A1-7126HCL | Recombinant Human CYP1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ERG28 Products
Required fields are marked with *
My Review for All ERG28 Products
Required fields are marked with *
0
Inquiry Basket