Recombinant Full Length Saccharomyces Cerevisiae Er-Retained Pma1-Suppressing Protein 1(Eps1) Protein, His-Tagged
Cat.No. : | RFL31282SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae ER-retained PMA1-suppressing protein 1(EPS1) Protein (P40557) (28-701aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (28-701) |
Form : | Lyophilized powder |
AA Sequence : | EPPEGFPEPLNPTNFKEELSKGLHIIDFYSPYCPHCKHLAPVWMETWEEFKEESKTLNIT FSQVNCIESADLCGDENIEYFPEIRLYNPSGYIKSFTETPRTKESLIAFARRESMDPNNL DTDLDSAKSESQYLEGFDFLELIAGKATRPHLVSFWPTKDMKNSDDSLEFKNCDKCHEFQ RTWKIISRQLAVDDINTGHVNCESNPTICEELGFGDLVKITNHRADREPKVALVLPNKTS NNLFDYPNGYSAKSDGYVDFARRTFTNSKFPNITEGELEKKANRDIDFLQERGRVTNNDI HLVFSYDPETVVIEDFDILEYLIEPLSKIPNIYLHQIDKNLINLSRNLFGRMYEKINYDA SQTQKVFNKEYFTMNTVTQLPTFFMFKDGDPISYVFPGYSTTEMRNIDAIMDWVKKYSNP LVTEVDSSNLKKLISFQTKSYSDLAIQLISSTDHKHIKGSNKLIKNLLLASWEYEHIRME NNFEEINERRARKADGIKKIKEKKAPANKIVDKMREEIPHMDQKKLLLGYLDISKEKNFF RKYGITGEYKIGDVIIIDKSNNYYYNKDNFGNSLTSNNPQLLREAFVSLNIPSKALYSSK LKGRLINSPFHNVLSFLDIIHGNGMPGYLIVIVLFIAILKGPSIYRRYKVRKHYRAKRNA VGILGNMEKKKNQD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | EPS1 |
Synonyms | EPS1; YIL005W; YIA5W; ER-retained PMA1-suppressing protein 1 |
UniProt ID | P40557 |
◆ Recombinant Proteins | ||
EGFR-31HAF647 | Active Recombinant Human EGFR Protein, His-GST-tagged, Alexa Fluor 647 conjugated | +Inquiry |
LMBRD1-400C | Recombinant Cynomolgus Monkey LMBRD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LILRB2-4474H | Recombinant Human LILRB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SAOUHSC-03002-1560S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_03002 protein, His-tagged | +Inquiry |
ABHD16B-2405H | Recombinant Human ABHD16B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
COL6A1-001B | Native Bovine COL6A1 Protein | +Inquiry |
APOC1-27328TH | Native Human APOC1 protein | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
COD-39 | Active Native Choline oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPRIN3-5767HCL | Recombinant Human GPRIN3 293 Cell Lysate | +Inquiry |
CBLB-7814HCL | Recombinant Human CBLB 293 Cell Lysate | +Inquiry |
Heart Ventricle-219H | Human Heart Ventricle (LT) (Diseased) Lysate | +Inquiry |
HAUS6-5628HCL | Recombinant Human HAUS6 293 Cell Lysate | +Inquiry |
IPMK-866HCL | Recombinant Human IPMK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPS1 Products
Required fields are marked with *
My Review for All EPS1 Products
Required fields are marked with *
0
Inquiry Basket