Recombinant Full Length Saccharomyces Cerevisiae Er-Derived Vesicles Protein Erv29(Erv29) Protein, His-Tagged
Cat.No. : | RFL10891SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae ER-derived vesicles protein ERV29(ERV29) Protein (P53337) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MSYRGPIGNFGGMPMSSSQGPYSGGAQFRSNQNQSTSGILKQWKHSFEKFASRIEGLTDN AVVYKLKPYIPSLSRFFIVATFYEDSFRILSQWSDQIFYLNKWKHYPYFFVVVFLVVVTV SMLIGASLLVLRKQTNYATGVLCACVISQALVYGLFTGSSFVLRNFSVIGGLLIAFSDSI VQNKTTFGMLPELNSKNDKAKGYLLFAGRILIVLMFIAFTFSKSWFTVVLTIIGTICFAI GYKTKFASIMLGLILTFYNITLNNYWFYNNTKRDFLKYEFYQNLSIIGGLLLVTNTGAGE LSVDEKKKIY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERV29 |
Synonyms | ERV29; YGR284C; ER-derived vesicles protein ERV29 |
UniProt ID | P53337 |
◆ Recombinant Proteins | ||
RFL27043NF | Recombinant Full Length Nostoc Punctiforme Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
YULC-1998B | Recombinant Bacillus subtilis YULC protein, His-tagged | +Inquiry |
PPAP2D-4935Z | Recombinant Zebrafish PPAP2D | +Inquiry |
NARS2-4614Z | Recombinant Zebrafish NARS2 | +Inquiry |
BIN-2338S | Recombinant Staphylococcus aureus (strain: CDC61, other: HA-MRSA) BIN protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
DNase-24B | Active Native Bovine Deoxyribonuclease | +Inquiry |
IgG-05T | Native Toxoplasma gondii IgG antigen, RH strain | +Inquiry |
C9-58H | Native Human Complement C9 | +Inquiry |
FGA-58R | Native Rabbit Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ovary-801G | Guinea Pig Ovary Membrane Lysate, Total Protein | +Inquiry |
HECTD2-5591HCL | Recombinant Human HECTD2 293 Cell Lysate | +Inquiry |
OR2A4-3565HCL | Recombinant Human OR2A4 293 Cell Lysate | +Inquiry |
JMJD7-350HCL | Recombinant Human JMJD7 lysate | +Inquiry |
REG4-979HCL | Recombinant Human REG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERV29 Products
Required fields are marked with *
My Review for All ERV29 Products
Required fields are marked with *
0
Inquiry Basket