Recombinant Full Length Saccharomyces Cerevisiae Cytochrome Oxidase Assembly Protein Shy1(Shy1) Protein, His-Tagged
Cat.No. : | RFL3236SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Cytochrome oxidase assembly protein SHY1(SHY1) Protein (P53266) (1-389aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-389) |
Form : | Lyophilized powder |
AA Sequence : | MSLLGARSTYRWFSIAASIPTKNAIGKSTYLLASRNQQYRGIITSTVDWKPIKTGKSPND DSRRERSFGKKIVLGLMFAMPIISFYLGTWQVRRLKWKTKLIAACETKLTYEPIPLPKSF TPDMCEDWEYRKVILTGHFLHNEEMFVGPRKKNGEKGYFLFTPFIRDDTGEKVLIERGWI SEEKVAPDSRNLHHLSLPQEEHLKVVCLVRPPKKRGSLQWAKKDPNSRLWQVPDIYDMAR SSGCTPIQFQALYDMKDHPIIEEHTRNEASQNNSTSSLWKFWKREPTTAVNGTQAVDNNT SKPRSRQEMPTDQTIEFDERQFIKAGVPIGRKPTIDLKNNHLQYLVTWYGLSFLSTIFLI VALRKAKRGGVVSQDQLMKEKLKHSRKYM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SHY1 |
Synonyms | SHY1; YGR112W; G6150; Cytochrome oxidase assembly protein SHY1; SURF1 homolog of Yeast; SURF1-like protein |
UniProt ID | P53266 |
◆ Recombinant Proteins | ||
PRLR-135H | Recombinant Human PRLR Protein, His (Fc)-Avi-tagged | +Inquiry |
C12orf57-1242H | Recombinant Human C12orf57 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDLIM7-3483H | Recombinant Human PDLIM7,LMP1 protein, His-tagged | +Inquiry |
RFL19623NF | Recombinant Full Length Nitrosomonas Europaea Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
DYRK1A-7655HF | Active Recombinant Full Length Human DYRK1A Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
IGHG3-231H | Native Human Immunoglobulin G3 (IgG3) | +Inquiry |
Actin-3084R | Active Native Rabbit Actin Protein | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXQ1-6144HCL | Recombinant Human FOXQ1 293 Cell Lysate | +Inquiry |
MYZAP-5976HCL | Recombinant Human GCOM1 293 Cell Lysate | +Inquiry |
DPH3-6836HCL | Recombinant Human DPH3 293 Cell Lysate | +Inquiry |
POP7-3009HCL | Recombinant Human POP7 293 Cell Lysate | +Inquiry |
MRI1-4203HCL | Recombinant Human MRI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SHY1 Products
Required fields are marked with *
My Review for All SHY1 Products
Required fields are marked with *
0
Inquiry Basket