Recombinant Full Length Saccharomyces Cerevisiae Cholinephosphotransferase 1(Cpt1) Protein, His-Tagged
Cat.No. : | RFL21896SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Cholinephosphotransferase 1(CPT1) Protein (P17898) (1-393aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-393) |
Form : | Lyophilized powder |
AA Sequence : | MGFFIPQSSLGNLKLYKYQSDDRSFLSNHVLRPFWRKFATIFPLWMAPNLVTLLGFCFII FNVLTTLYYDPYFDQESPRWTYFSYAIGLFLYQTFDACDGMHARRTGQQGPLGELFDHCI DSINTTLSMIPVCSMTGMGYTYMTIFSQFAILCSFYLSTWEEYHTHKLYLAEFCGPVEGI IVLCISFIAVGIYGPQTIWHTKVAQFSWQDFVFDVETVHLMYAFCTGALIFNIVTAHTNV VRYYESQSTKSATPSKTAENISKAVNGLLPFFAYFSSIFTLVLIQPSFISLALILSIGFS VAFVVGRMIIAHLTMQPFPMVNFPFLIPTIQLVLYAFMVYVLDYQKGSIVSALVWMGLGL TLAIHGMFINDIIYDITTFLDIYALSIKHPKEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CPT1 |
Synonyms | CPT1; YNL130C; N1218; N1867; Cholinephosphotransferase 1; Aminoalcohol phosphotransferase CPT1; Diacylglycerol cholinephosphotransferase 1; Sn-1,2-diacylglycerol cholinephosphotransferase; CHOPT |
UniProt ID | P17898 |
◆ Native Proteins | ||
FABP-178R | Native Rat Fatty acid Binding Protein | +Inquiry |
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
TF-261M | Native Monkey Transferrin | +Inquiry |
IGHG3-231H | Native Human Immunoglobulin G3 (IgG3) | +Inquiry |
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF192-1993HCL | Recombinant Human ZNF192 cell lysate | +Inquiry |
DHX40-6928HCL | Recombinant Human DHX40 293 Cell Lysate | +Inquiry |
AUP1-54HCL | Recombinant Human AUP1 lysate | +Inquiry |
CCT2-7691HCL | Recombinant Human CCT2 293 Cell Lysate | +Inquiry |
WNT2-298HCL | Recombinant Human WNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPT1 Products
Required fields are marked with *
My Review for All CPT1 Products
Required fields are marked with *
0
Inquiry Basket