Recombinant Full Length Saccharomyces Cerevisiae Autophagy-Related Protein 33(Atg33) Protein, His-Tagged
Cat.No. : | RFL3881SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Autophagy-related protein 33(ATG33) Protein (C7GRY1) (1-197aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-197) |
Form : | Lyophilized powder |
AA Sequence : | MSVCLAITKGIAVSSIGLYSGLLASASLITSTTPLEVLTGSLTPTLTTLKNAATALGAFA STFFCVSFFGAPPSLRHPYLLYGMLAAPLSSFVLGCASNYQSRKYSKVSKESSLFPEDSK PAASELSDSIIDLGEDNHASENTPRDGKPAATTVSKPAEALHTGPPIHTKNLIAATAIAI VGFVQAVIGVYGEGQFI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG33 |
Synonyms | ATG33; C1Q_03121; Autophagy-related protein 33 |
UniProt ID | C7GRY1 |
◆ Recombinant Proteins | ||
AROE-0557B | Recombinant Bacillus subtilis AROE protein, His-tagged | +Inquiry |
ROS1-1185H | Recombinant Human ROS1 protein, His & T7-tagged | +Inquiry |
LOX-1092H | Recombinant Human LOX Protein, His-tagged | +Inquiry |
RFL35524HF | Recombinant Full Length Human Mitoferrin-1(Slc25A37) Protein, His-Tagged | +Inquiry |
MAP2K1-2483R | Recombinant Rhesus Macaque MAP2K1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GPT-26879TH | Native Human GPT | +Inquiry |
AFP-3017H | Native Human fetal cord serum | +Inquiry |
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
COL1-118H | Native Human Collagen Type I protein | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFYA-3841HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
CNOT4-7401HCL | Recombinant Human CNOT4 293 Cell Lysate | +Inquiry |
CAST-7824HCL | Recombinant Human CAST 293 Cell Lysate | +Inquiry |
ANGPTL5-704HCL | Recombinant Human ANGPTL5 cell lysate | +Inquiry |
UBASH3A-597HCL | Recombinant Human UBASH3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATG33 Products
Required fields are marked with *
My Review for All ATG33 Products
Required fields are marked with *
0
Inquiry Basket