Recombinant Full Length Saccharomyces Cerevisiae Autophagy-Related Protein 32(Atg32) Protein, His-Tagged
Cat.No. : | RFL34616SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Autophagy-related protein 32(ATG32) Protein (C8ZAW6) (1-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-529) |
Form : | Lyophilized powder |
AA Sequence : | MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD EDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL KSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYC RNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV KSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG32 |
Synonyms | ATG32; ECM17; EC1118_1I12_0265g; Autophagy-related protein 32; Extracellular mutant protein 37 |
UniProt ID | C8ZAW6 |
◆ Recombinant Proteins | ||
GFER-216H | Recombinant Human GFER, His-SUMO-tagged | +Inquiry |
SDCBP-6253H | Recombinant Human SDCBP Protein (Ser2-Val298), C-His tagged | +Inquiry |
CRYAB-1037R | Recombinant Rhesus monkey CRYAB Protein, His-tagged | +Inquiry |
PELI1-2335H | Recombinant Human PELI1 protein, His-tagged | +Inquiry |
PLK133712H | Recombinant Human PLK1 (13-345) (T210V) Protein | +Inquiry |
◆ Native Proteins | ||
IgA-130H | Native Human Immunoglobulin A | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
Ferritin-181R | Native Rat Ferritin | +Inquiry |
FGA-6H | Native Human Fibrinogen Protein, Alexa Fluor 488 labeled | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIGN-3196HCL | Recombinant Human PIGN 293 Cell Lysate | +Inquiry |
NFE2L2-3854HCL | Recombinant Human NFE2L2 293 Cell Lysate | +Inquiry |
TUBA4A-656HCL | Recombinant Human TUBA4A 293 Cell Lysate | +Inquiry |
TMEM19-682HCL | Recombinant Human TMEM19 lysate | +Inquiry |
NDRG4-3928HCL | Recombinant Human NDRG4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG32 Products
Required fields are marked with *
My Review for All ATG32 Products
Required fields are marked with *
0
Inquiry Basket