Recombinant Full Length Ross River Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL26108RF |
Product Overview : | Recombinant Full Length Ross river virus Structural polyprotein Protein (P13890) (817-1254aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ross River Virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (817-1254) |
Form : | Lyophilized powder |
AA Sequence : | YEHTATIPNVVGFPYKAHIERNXFSPMTLQLEVVXXSLEPTLNLEYITCEYKTVVPSPFI KCCGTSECSSKEQPDYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCKHDHAL AYKAHTASLKATIRISYGTINQTTEAFVNGEHAVNVGGSKFIFGPISTAWSPFDNKIVVY KDDVYNQDFPPYGSGQPGRFGDIQSRTVESKDLYANTALKLSRPSPGVVHVPYTQTPSGF KYWLKEKGSSLNTKAPFGCKIKTNPVRAMDCAVGSIPVSMDIPDSAFTRVVDAPAVTDLS CQVAVCTHSSDFGXVATLSYKTDKPGKCAVHSHSNVATLQEATVDVKEDGKVTVHFSXXS ASPAFKVSVCDAKTTCTAACEPPKDHIVPYGASHNNQVFPDMSGTAMTWVQRMASGLGGL ALIAVVVLVLVTCITMRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ross river virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | P13890 |
◆ Recombinant Proteins | ||
SE0644-3290S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0644 protein, His-tagged | +Inquiry |
TYW5-17680M | Recombinant Mouse TYW5 Protein | +Inquiry |
FOXP1-5163H | Recombinant Human FOXP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COTL1-4425H | Recombinant Human COTL1 protein, His-SUMO-tagged | +Inquiry |
RFL21914RF | Recombinant Full Length Rat Mas-Related G-Protein Coupled Receptor Member X1(Mrgprx1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
Interferon alfa-P029H | Native Human interferon alpha therapeutic protein (Interferon alfa-n3) | +Inquiry |
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPVL-7297HCL | Recombinant Human CPVL 293 Cell Lysate | +Inquiry |
C19orf53-8202HCL | Recombinant Human C19orf53 293 Cell Lysate | +Inquiry |
ADAM19-9038HCL | Recombinant Human ADAM19 293 Cell Lysate | +Inquiry |
RAB33A-2606HCL | Recombinant Human RAB33A 293 Cell Lysate | +Inquiry |
COLEC11-001MCL | Recombinant Mouse COLEC11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Ross river virus Structural polyprotein Products
Required fields are marked with *
My Review for All Ross river virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket