Recombinant Full Length Rickettsia Bellii Surf1-Like Protein(Rbe_0359) Protein, His-Tagged
Cat.No. : | RFL26016RF |
Product Overview : | Recombinant Full Length Rickettsia bellii SURF1-like protein(RBE_0359) Protein (Q1RJM4) (1-241aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia bellii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-241) |
Form : | Lyophilized powder |
AA Sequence : | MKTKLTVLITFIILVLLGFWQLNRLKEKKLFLASMQENLTSPAIDLAKIQDNLPYHKVKI TGHFLPDKDIYLYGRRSMSSEKDGYYLVTPFKTDEDKIILVARGWFSNRNKNIITQATND QPHELIGVTMPSEKTRSYLPANDIKNNVWLTLDLQEASKVLGLNLENFYLIEESKDISNL DILLPLSINHLAAIRNDHLEYAFTWFGLAASLVVIYRIYKRSVSSRGLETRSRIKQDKSS F |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RBE_0359 |
Synonyms | RBE_0359; SURF1-like protein |
UniProt ID | Q1RJM4 |
◆ Native Proteins | ||
C-type lectin like protein-043H | Native Hen C-type lectin like protein Protein, Peroxidase conjugated | +Inquiry |
Cry2Ab-37B | Native Bacillus thuringiensis Cry2Ab Protein | +Inquiry |
Ferritin-027H | Native Human Ferritin Protein, apo form | +Inquiry |
DNA-005C | Native Calf DNA | +Inquiry |
IGHG3-120H | Native Human Immunoglobulin G3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROK2-2835HCL | Recombinant Human PROK2 293 Cell Lysate | +Inquiry |
CRYGD-7257HCL | Recombinant Human CRYGD 293 Cell Lysate | +Inquiry |
SMPDL3A-1216HCL | Recombinant Human SMPDL3A cell lysate | +Inquiry |
HTR1E-5336HCL | Recombinant Human HTR1E 293 Cell Lysate | +Inquiry |
TRAPPC6A-805HCL | Recombinant Human TRAPPC6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBE_0359 Products
Required fields are marked with *
My Review for All RBE_0359 Products
Required fields are marked with *
0
Inquiry Basket