Recombinant Full Length Rickettsia Bellii Putative Export Atp-Binding/Permease Protein Rbe_0492(Rbe_0492) Protein, His-Tagged
Cat.No. : | RFL26525RF |
Product Overview : | Recombinant Full Length Rickettsia bellii Putative export ATP-binding/permease protein RBE_0492(RBE_0492) Protein (Q1RJ91) (1-575aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia bellii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-575) |
Form : | Lyophilized powder |
AA Sequence : | MNTKLLYRLARNLRFYKKDLIIVIISLLSVSLALLLIGNVFRNLVDQGLVLDRTAAVDKS ILYICLLIIILSIASFFRSYFINNVAEKVSSQIRKEAYSNLINYEITEFEELKIGDIISR LTSDIDQISKLIVNFLSFFIRNSVMLVGSIILMFFESFKLASIVIITIPLLLIPIIKFGK HVKALSKKTLESQSLLASDINESFSNIKTIHAFGGQAAKITEFNNLLQDYLTYSAARLKI RALFFAFSMAFIFLGVTLVIWIGALDIVKGNLSSGQIISFIYYAIIAGFSSGGIFELLSE MHLPLAALERIVTIIDKSPIVHNNYSDLKPVNSISLEFKNVNFSYPSRPNLKILNNISFK IDSTQFIGIVGRSGSGKSTLMQLLLRFYVQESGIILVNNQDIALLNPNEIRKLIAYVPQE ASIFSGTIKSNIMFGNDSSEEEITEIIKITGIADFTDKIPDGINAKIGEKGVRLSGGQKQ RIALARALLRKPQILLLDEAMNALDSQSEQKLLSSIRDIMKGKIVISIAHRISSIESADN ILIIDKGAVEAEGTHAHLLKTSDLYRTIYKEVDLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RBE_0492 |
Synonyms | RBE_0492; Putative export ATP-binding/permease protein RBE_0492 |
UniProt ID | Q1RJ91 |
◆ Recombinant Proteins | ||
YPGR-3002B | Recombinant Bacillus subtilis YPGR protein, His-tagged | +Inquiry |
PER3-9125Z | Recombinant Zebrafish PER3 | +Inquiry |
BICC1-4351C | Recombinant Chicken BICC1 | +Inquiry |
RPL19-4773R | Recombinant Rat RPL19 Protein, His (Fc)-Avi-tagged | +Inquiry |
TSHB-105H | Active Recombinant Human TSHB+TSHA co-expressed protein | +Inquiry |
◆ Native Proteins | ||
Hemocyanin-30S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
ELANE-3221H | Active Native Human ELANE Protein | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
FGB-59R | Native Rabbit Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
MXI1-4046HCL | Recombinant Human MXI1 293 Cell Lysate | +Inquiry |
BCL2L12-8487HCL | Recombinant Human BCL2L12 293 Cell Lysate | +Inquiry |
DHFRL1-6945HCL | Recombinant Human DHFRL1 293 Cell Lysate | +Inquiry |
STIP1-641HCL | Recombinant Human STIP1 lysate | +Inquiry |
MARVELD2-4462HCL | Recombinant Human MARVELD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBE_0492 Products
Required fields are marked with *
My Review for All RBE_0492 Products
Required fields are marked with *
0
Inquiry Basket