Recombinant Full Length Rhodopseudomonas Palustris Protease Htpx Homolog(Htpx) Protein, His-Tagged
Cat.No. : | RFL8265RF |
Product Overview : | Recombinant Full Length Rhodopseudomonas palustris Protease HtpX homolog(htpX) Protein (Q13D27) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodopseudomonas palustris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MSYFKTAMLLAGLTALFMGIGYLIGGASGALIALVVAAAMNVFTYWNSDRMVLSMYGAQE VDVRSAPDLVRMVAELAGRAGLPMPRVFIMDNPQPNAFATGRNPENAAVAVTTGLMQQLS REELAGVIAHELAHVKNHDTLLMTITATIAGAISMVAQFGMFFGGNRENNNGPGLIGSLA LMILAPLGAMLVQMAISRTREYAADEMGARICGQPMWLASALGRIDAAAHQVPNVEAERA PATAHMFIINPLSGQGMDNLFATHPSTQNRIAALQRLTGEIGGGGASIGRPAGPSPRGAP RSPWSGQPRARGPWG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | htpX |
Synonyms | htpX; RPD_0774; Protease HtpX homolog |
UniProt ID | Q13D27 |
◆ Recombinant Proteins | ||
TRIM46B-5394Z | Recombinant Zebrafish TRIM46B | +Inquiry |
XCL1-159H | Active Recombinant Human XCL1, HIgG1 Fc-tagged, mutant | +Inquiry |
Tnfsf13-401M | Recombinant Mouse Tnfsf13, FLAG-tagged | +Inquiry |
DGKG-2574H | Recombinant Human DGKG Protein, GST-tagged | +Inquiry |
PARVB-3781H | Recombinant Human PARVB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VTN-386R | Native Rabbit Vitronectin | +Inquiry |
CGB-359H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
TF-172S | Native Sheep transferrin | +Inquiry |
AMBP-27H | Native Human AMBP | +Inquiry |
CA 19-9-135 | Active Native Human CA 19-9 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GNT2-1396HCL | Recombinant Human B3GNT2 cell lysate | +Inquiry |
CAMK1D-7882HCL | Recombinant Human CAMK1D 293 Cell Lysate | +Inquiry |
EID2B-6681HCL | Recombinant Human EID2B 293 Cell Lysate | +Inquiry |
CD1D & B2M-001HCL | Recombinant Human CD1D & B2M cell lysate | +Inquiry |
STK11-1410HCL | Recombinant Human STK11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All htpX Products
Required fields are marked with *
My Review for All htpX Products
Required fields are marked with *
0
Inquiry Basket