Recombinant Full Length Rhodobacter Sphaeroides Sensor Histidine Kinase Regb(Regb) Protein, His-Tagged
Cat.No. : | RFL17481RF |
Product Overview : | Recombinant Full Length Rhodobacter sphaeroides Sensor histidine kinase regB(regB) Protein (Q3J6C1) (1-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodobacter Sphaeroides |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-462) |
Form : | Lyophilized powder |
AA Sequence : | MILGPDGILNRDTRGDWVRLRTLILLRWMAVAGQLAAIVVTDWYLGVRLPMGLCFMAVGA SVIANVIATFVFPQNRRLTEFQALMILLFDLTQLSFLLFLTGGLTNPFALLILAPVTISA LALELRTTVILGAIAIGLLTFTAYFHLPLILADGSSLSVPRMFEFGFWLAIVIGILFLGL YSRRVAIEIRSMSDALLATQMALDREQKLTDLGGVVAAAAHELGTPLATIKLVSSELAEE LSEQPALRDDAELIREQADRCRDILRSMGRAGKDDLQMRQAPLGEVLREAAEPHVGRGKR VEFDLYPSRGGDERQPVILRRPEVIHGLRNLIQNAVDFARSTVWIDGEWTGDRIAIRIVD DGEGYPPAIIGRIGDPFVRQRRAEESQSRRPGYEGMGLGLFIAKTLLERSGAELSFANAA DPFLRSHERPERCGAIVEVIWPVDRLVVVRNAPLGENVLIQT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | regB |
Synonyms | regB; prrB; RHOS4_00950; RSP_1520; Sensor histidine kinase RegB; Protein PrrB |
UniProt ID | Q3J6C1 |
◆ Recombinant Proteins | ||
LGALS3BP-1544H | Recombinant Human LGALS3BP, T7-tagged | +Inquiry |
ARHGAP26-1193HF | Recombinant Full Length Human ARHGAP26 Protein, GST-tagged | +Inquiry |
HBS1L-2802R | Recombinant Rat HBS1L Protein | +Inquiry |
CLEC12A-2115HF | Recombinant Full Length Human CLEC12A Protein | +Inquiry |
KLHL6-1401Z | Recombinant Zebrafish KLHL6 | +Inquiry |
◆ Native Proteins | ||
Factor Xa-64H | Native Human Factor Xa | +Inquiry |
IgM-338H | Native Horse IgM | +Inquiry |
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
HP-200H | Native Human Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC11-8868HCL | Recombinant Human ANAPC11 293 Cell Lysate | +Inquiry |
CD80-948CCL | Recombinant Cynomolgus CD80 cell lysate | +Inquiry |
ZNF280A-103HCL | Recombinant Human ZNF280A 293 Cell Lysate | +Inquiry |
MYOZ2-4001HCL | Recombinant Human MYOZ2 293 Cell Lysate | +Inquiry |
GJA1-5923HCL | Recombinant Human GJA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All regB Products
Required fields are marked with *
My Review for All regB Products
Required fields are marked with *
0
Inquiry Basket