Recombinant Full Length Rhodobacter Sphaeroides Reaction Center Protein L Chain(Pufl) Protein, His-Tagged
Cat.No. : | RFL34631RF |
Product Overview : | Recombinant Full Length Rhodobacter sphaeroides Reaction center protein L chain(pufL) Protein (P0C0Y8) (2-282aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodobacter Sphaeroides |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-282) |
Form : | Lyophilized powder |
AA Sequence : | ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIAWSAVLQGTWN PQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSWALREVEICRKLGIGYHIPFA FAFAILAYLTLVLFRPVMMGAWGYAFPYGIWTHLDWVSNTGYTYGNFHYNPAHMIAISFF FTNALALALHGALVLSAANPEKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSA VFFSALCMIITGTIWFDQWVDWWQWWVKLPWWANIPGGING |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pufL |
Synonyms | pufL; Reaction center protein L chain; Photosynthetic reaction center L subunit |
UniProt ID | P0C0Y8 |
◆ Recombinant Proteins | ||
MLPH-3829C | Recombinant Chicken MLPH | +Inquiry |
AYP1020-RS02715-5088S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS02715 protein, His-tagged | +Inquiry |
POU3F2-132H | Recombinant Human POU3F2 protein, Arginine-tagged | +Inquiry |
CYP4F2-85H | Recombinant Human CYP4F2 Protein | +Inquiry |
TAS2R126-9011M | Recombinant Mouse TAS2R126 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
FTL-673H | Native Human Ferritin, Light Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5C-1225HCL | Recombinant Human NT5C cell lysate | +Inquiry |
TMEM70-934HCL | Recombinant Human TMEM70 293 Cell Lysate | +Inquiry |
MAK16-4531HCL | Recombinant Human MAK16 293 Cell Lysate | +Inquiry |
RBM39-2471HCL | Recombinant Human RBM39 293 Cell Lysate | +Inquiry |
TF-1208MCL | Recombinant Mouse TF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pufL Products
Required fields are marked with *
My Review for All pufL Products
Required fields are marked with *
0
Inquiry Basket