Recombinant Full Length Rhodobacter Capsulatus Atp Synthase Subunit B'(Atpg) Protein, His-Tagged
Cat.No. : | RFL21016RF |
Product Overview : | Recombinant Full Length Rhodobacter capsulatus ATP synthase subunit b'(atpG) Protein (O05332) (1-186aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodobacter capsulatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-186) |
Form : | Lyophilized powder |
AA Sequence : | MANETNAVEAAAAVAGHAAEAAEKGGMPQLDFSTFPNQIFWLLLALGAIYWLLKNIAIPR IAAILADRAGTISGDLAAAEQYKLKAKDAEAAYAKALADARAQAQKIIAETRAVIQKDLD AATAKADADIAARVAQSEVKIAEIRAGALEAVQIVATDTATAIVTALGGKADMGALNAAV GQRVKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | atpG |
Synonyms | atpF2; atpG; atpX; ATP synthase subunit b'; ATP synthase F(0 sector subunit b'; ATPase subunit II; F-type ATPase subunit b'; F-ATPase subunit b' |
UniProt ID | O05332 |
◆ Native Proteins | ||
CSK-27872TH | Native Human CSK | +Inquiry |
LH-92P | Native Porcine LH | +Inquiry |
C4B-1846H | Native Human C4B Protein | +Inquiry |
HDL-397H | Native Human High Density Lipoprotein, DiI labeled | +Inquiry |
HbA0-9382H | Native Human Hemoglobin A0, Ferrous Stabilized | +Inquiry |
◆ Cell & Tissue Lysates | ||
F3-1256RCL | Recombinant Rat F3 cell lysate | +Inquiry |
GST-573SCL | Recombinant Schistosoma japonicum GST cell lysate | +Inquiry |
HT-29-01HL | Human HT-29 lysate | +Inquiry |
EDEM3-6724HCL | Recombinant Human EDEM3 293 Cell Lysate | +Inquiry |
SPATA2L-1535HCL | Recombinant Human SPATA2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All atpG Products
Required fields are marked with *
My Review for All atpG Products
Required fields are marked with *
0
Inquiry Basket