Recombinant Full Length Rhizopus Oryzae Fk506-Binding Protein 2A(Fkbp2) Protein, His-Tagged

• Cat.No.: RFL27816RF
• Product Overview: Recombinant Full Length Rhizopus oryzae FK506-binding protein 2A(FKBP2) Protein (P0C1J4) (22-167aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length of Mature Protein (22-167)
• AA Sequence: AKSESTINKPEKCGLKASSSSTVRIHYRSRVWGQEEYFESTYIREAPLEVKLGNGNLLKG IEDGIHGMCTGEIRRLLIPPNQAYGAIGIPNLVPPNTAIVVDVEMVNVNSPFSLWFWISG LILFSAFLLFGRKPIKGDTSNIKKKE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: FKBP2
• Synonyms: FKBP2; fpr2; RO3G_06709; FK506-binding protein 2A; Peptidyl-prolyl cis-trans isomerase; PPIase; Rotamase
• UniProt ID: P0C1J4