Recombinant Full Length Rhizobium Sp. Uncharacterized Protein Y4Yq (Ngr_A00540) Protein, His-Tagged
Cat.No. : | RFL9451SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Uncharacterized protein y4yQ (NGR_a00540) Protein (P55725) (1-296aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-296) |
Form : | Lyophilized powder |
AA Sequence : | MNDAISLQFKVISGLYCELTGTTALETSLIGSGLDADIVFVEQGLAPHHFRVTLLGKTLE VEALAAGLSIEGNGNIAAGERVVAPLPVVIHAGAMSILWSVQDAASSGSIGKPRLSISVL ALVLLGSLGIGVLSAIFSYYDNAVVSNADLSGEAREPKLPDNRTDDETAFTAAKALQQEV DRAGLSNIKISAAEGVVTVEGTVTSASAISWHKVQQWFDHRTRGALALLNGVIIDDEKAP SAIAVEAVWRGSLPYLVIKGEKYFVGALLDDGWMVERIEDGRVMLSRNGRLAAVPY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NGR_a00540 |
Synonyms | NGR_a00540; y4yQ; Uncharacterized protein y4yQ |
UniProt ID | P55725 |
◆ Recombinant Proteins | ||
RFL21353BF | Recombinant Full Length Buchnera Aphidicola Subsp. Acyrthosiphon Pisum Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged | +Inquiry |
IFNB1-8538H | Recombinant Human IFNB1 | +Inquiry |
DHX29-11983H | Recombinant Human DHX29, His-tagged | +Inquiry |
DHDH-6662H | Recombinant Human DHDH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NR1H3-1377H | Recombinant Human NR1H3 Protein, His/SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
MYH-11R | Active Native Rabbit Myosin II Protein | +Inquiry |
Collagen Type I & III-07P | Native Porcine Collagen Type I and III Protein | +Inquiry |
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
E2-01H | Native Human Estradiol (E2) | +Inquiry |
F2-73R | Native Rat Prothrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM216B-8299HCL | Recombinant Human C13orf30 293 Cell Lysate | +Inquiry |
DMRT1-6898HCL | Recombinant Human DMRT1 293 Cell Lysate | +Inquiry |
HCFC1R1-5613HCL | Recombinant Human HCFC1R1 293 Cell Lysate | +Inquiry |
CREB3-396HCL | Recombinant Human CREB3 cell lysate | +Inquiry |
UROC1-484HCL | Recombinant Human UROC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGR_a00540 Products
Required fields are marked with *
My Review for All NGR_a00540 Products
Required fields are marked with *
0
Inquiry Basket