Recombinant Full Length Rhizobium Sp. Uncharacterized Protein Y4Ba/Y4Ph (Ngr_A00280) Protein, His-Tagged
Cat.No. : | RFL32918SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Uncharacterized protein y4bA/y4pH (NGR_a00280) Protein (P55368) (1-694aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-694) |
Form : | Lyophilized powder |
AA Sequence : | MSTDIAIKVDADHLRRDAFLYVRQSSLRQVFENTESTKRQYALRDRAVALGWPIERVHVI DSDLGLSGAQSQDRDGFQHLVSEVAMGHAGIVLGLEVSRLARNNADWHRLLELAALSRTL IMDEDGVYDPAYFNDRMLLGLKGTMSEAELHILKSRLQGGILNKARRGELEMPLPIGLVY TPDARVVLDPDRQIQDTVRLLFDTFRQTGSACAVVRRLRGEKILFPRRIRRGIGKGDVLW NEIDHSRVLQILHNPRYAGAFAYGRTRTAYNAKLKPVQLRVARSDWQVLIPDAHDGYISW AEYERNQAALEQNATGFSPGLRGRMPRQGSGLLQGRLLCGRCGARMRVHYEPFEGRLRPY YVCNEAVVRHAGKHCQWVRGAPVDEAVSALLLEVMAPAAIDVALAVQQEITQRVEQAAAL RGTQLQRARYEAELARRRYLKVDPDNRLVADALEADWNARLRDLDALQREHERQNEADHS LLDEPAQQRIRALTADFPRIWNDERTGAVERKRMLGLLIEDVTLLVDDEVNINIRWRGGR TQSLSVARPRPMSVIRKTPAQVVALINELLEATNDRQIAARLNELGHRNWRGEPFTPKKV MLVRRTYGLKSRYERLREGGMLTGEEVAQQLGVCESTVHQLGRKGTLKRHRYASNHRYLY EPPGNVRLEKGAGSRYGGRQPRLIVAQPLQQGAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NGR_a00280 |
Synonyms | NGR_a00280; y4bA; NGR_a02040; y4pH; Uncharacterized protein y4bA/y4pH |
UniProt ID | P55368 |
◆ Recombinant Proteins | ||
CD276-756HP | Recombinant Human CD276 protein, Fc-tagged, R-PE labeled | +Inquiry |
GPR155-5649HF | Recombinant Full Length Human GPR155 Protein | +Inquiry |
PDCD11-2422H | Recombinant Human PDCD11 protein, His-tagged | +Inquiry |
MYD88-7112H | Recombinant Human MYD88, His-tagged | +Inquiry |
Cd209a-7174M | Recombinant Mouse Cd209a protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
C1R-96H | Active Native Human C1r Enzyme | +Inquiry |
MB-02B | Native Bovine MB Protein | +Inquiry |
CNTF-26839TH | Native Human CNTF | +Inquiry |
Fga-63R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
LDL-406H | Native Human Low Density Lipoprotein, Acetylated, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C20orf11-8127HCL | Recombinant Human C20orf11 293 Cell Lysate | +Inquiry |
PCMTD2-1314HCL | Recombinant Human PCMTD2 cell lysate | +Inquiry |
TBL1Y-1213HCL | Recombinant Human TBL1Y 293 Cell Lysate | +Inquiry |
NKX3-3811HCL | Recombinant Human NKX3 293 Cell Lysate | +Inquiry |
GSKIP-8288HCL | Recombinant Human C14orf129 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGR_a00280 Products
Required fields are marked with *
My Review for All NGR_a00280 Products
Required fields are marked with *
0
Inquiry Basket