Recombinant Full Length Rhizobium Sp. Probable Translocation Protein Y4Yn (Ngr_A00590) Protein, His-Tagged
Cat.No. : | RFL28220SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Probable translocation protein y4yN (NGR_a00590) Protein (P55722) (1-272aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-272) |
Form : | Lyophilized powder |
AA Sequence : | MYLSPAEIQILLHAAIELVAAAGLGAARALGIMLILPVFTRSQIGGLIRGCLAIAFGLPC LAHVSDGLQAPDPETSLIQIPLLGLKEVFVGVLLGTFLGIPLWGLQAAGEFIDNQRGITS PSTQADPATNSQASAMGVFLGITAITIFVAAGGVEAVLSALYGSYSIWPVYRFQPTLSTQ GAVELFGLLDHIMRTTLLVSGPVVFFLGLIDISMMMLRRFAPQFKSGQLSPPIKNIVFPI IMVTYATYLLEGIKLEITQADGTLGWLDKLLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NGR_a00590 |
Synonyms | NGR_a00590; y4yN; Probable translocation protein y4yN |
UniProt ID | P55722 |
◆ Native Proteins | ||
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
HB-01H | Native Human HB Protein | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
Collagen Type IV-09H | Native Human Collagen Type IV | +Inquiry |
IgE-01M | Native Mouse IgE protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Liver-293P | Porcine Liver Lysate | +Inquiry |
OXGR1-3506HCL | Recombinant Human OXGR1 293 Cell Lysate | +Inquiry |
Eye-89M | Mouse Eye Tissue Lysate | +Inquiry |
MARC1-4246HCL | Recombinant Human MOSC1 293 Cell Lysate | +Inquiry |
GDNF-1549HCL | Recombinant Human GDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGR_a00590 Products
Required fields are marked with *
My Review for All NGR_a00590 Products
Required fields are marked with *
0
Inquiry Basket