Recombinant Full Length Rhizobium Radiobacter Protein Virb2(Virb2) Protein, His-Tagged
Cat.No. : | RFL28222RF |
Product Overview : | Recombinant Full Length Rhizobium radiobacter Protein virB2(virB2) Protein (P09776) (20-121aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-121) |
Form : | Lyophilized powder |
AA Sequence : | MMRVISSCAPSLGGAMAWSISSCGPAAAQSAGGGTDPATMVNNICTFILGPFGQSLAVLG IVAIGISWMFGRRSLGLVAGVVGGIVIMFGASFLGQTLTGGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virB2 |
Synonyms | virB2; Protein virB2 |
UniProt ID | P09776 |
◆ Recombinant Proteins | ||
RFL11757HF | Recombinant Full Length Human Mitochondrial Uncoupling Protein 2(Ucp2) Protein, His-Tagged | +Inquiry |
C9orf40-2698HF | Recombinant Full Length Human C9orf40 Protein, GST-tagged | +Inquiry |
CD37-0943H | Recombinant Human CD37 Protein (Thr110-Asn241), N-His tagged | +Inquiry |
IGSF8-312H | Recombinant Human IGSF8, His tagged | +Inquiry |
SPAG5-8605M | Recombinant Mouse SPAG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MB-4460H | Native Human Myoglobin | +Inquiry |
LTF-230B | Native Bovine Apo-Lactoferrin | +Inquiry |
Ferritin-024B | Native Bovine Ferritin Protein, holo form | +Inquiry |
Lectin-1848S | Active Native Soybean Agglutinin Protein | +Inquiry |
PROC-272B | Active Native Bovine Activated Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPZ1-1483HCL | Recombinant Human SPZ1 293 Cell Lysate | +Inquiry |
EZH1-6488HCL | Recombinant Human EZH1 293 Cell Lysate | +Inquiry |
Stomach-121M | Mouse Stomach Tissue Lysate | +Inquiry |
SRP9-1476HCL | Recombinant Human SRP9 293 Cell Lysate | +Inquiry |
SSR4-1457HCL | Recombinant Human SSR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All virB2 Products
Required fields are marked with *
My Review for All virB2 Products
Required fields are marked with *
0
Inquiry Basket