Recombinant Full Length Rhizobium Radiobacter Protein Virb10(Virb10) Protein, His-Tagged
Cat.No. : | RFL13405RF |
Product Overview : | Recombinant Full Length Rhizobium radiobacter Protein virB10(virB10) Protein (P09783) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MNNDSQQAAHEVDASGSLVSDKHRRRLSGSQKLIVGGVVLALSLSLIWLGGRQKKVNDNA SPSTLIAANTKPFHPAPIEVPPDTPAVQEAVQPTVPQPPRGEPERMSHGRKKHRFLHIAV AIKGSASAPVRATWAEDKKTSVTTTPCRMRSVRRERFVDTYETHRAAAQQGTLLPHPDFM VTQGTIIPCILQTAIDTNLAGYVKCVLPQDIRGTTNNIVLLDRGTTVVGEIQRGLQQGDE RVFVLWDRAETPDHAMISLTSPSADELGRPGLPGSVDSHFWQRFSGAMLLSAVQGAFQAA STYAGSSGGGMSFNSFQNNGEQTTETALKATINIPPTLKKNQGDTVSIFVARDLDFFGVY QLRLTGGAARGRNRRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virB10 |
Synonyms | virB10; Protein virB10 |
UniProt ID | P09783 |
◆ Recombinant Proteins | ||
OATA-2036B | Recombinant Bacillus subtilis OATA protein, His-tagged | +Inquiry |
MPXV-0847 | Recombinant Monkeypox Virus Protein, RNA helicase NPH-II | +Inquiry |
MUL1-1116H | Recombinant Human MUL1 | +Inquiry |
FIS1-2952H | Recombinant Human FIS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Prom1-33R | Recombinant Rat Prom1, His tagged | +Inquiry |
◆ Native Proteins | ||
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
CA50-01H | Active Native Human Cancer Antigen 50 protein | +Inquiry |
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
CA-13B | Active Native Bovine Carbonic Anhydrase | +Inquiry |
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP1-475HCL | Recombinant Human USP1 293 Cell Lysate | +Inquiry |
ENPP7-1835MCL | Recombinant Mouse ENPP7 cell lysate | +Inquiry |
GBX2-5996HCL | Recombinant Human GBX2 293 Cell Lysate | +Inquiry |
BIK-65HCL | Recombinant Human BIK lysate | +Inquiry |
SLFN5-611HCL | Recombinant Human SLFN5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All virB10 Products
Required fields are marked with *
My Review for All virB10 Products
Required fields are marked with *
0
Inquiry Basket