Recombinant Full Length Rhizobium Meliloti Probable K(+)/H(+) Antiporter Subunit C(Phac) Protein, His-Tagged
Cat.No. : | RFL32637RF |
Product Overview : | Recombinant Full Length Rhizobium meliloti Probable K(+)/H(+) antiporter subunit C(phaC) Protein (Q52980) (1-115aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium Meliloti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-115) |
Form : | Lyophilized powder |
AA Sequence : | MELILSAGIGTLTASGVYLLLRPRTYQVIIGLSLLSFAVNLFIFGMGRLRVNAPPILDPG GVGDLARYTDPVPQALVLTAIVIGFAMTALFLVVLLASRGFTGTDHVDGREQRGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | phaC |
Synonyms | phaC; phaC1; R02911; SMc03180; Probable K(+/H(+ antiporter subunit C; pH adaptation potassium efflux system protein C; Pha system subunit C |
UniProt ID | Q52980 |
◆ Recombinant Proteins | ||
RFL6461LF | Recombinant Full Length Lactobacillus Reuteri Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
TXNL4B-4025H | Recombinant Human TXNL4B protein, His-tagged | +Inquiry |
RFL36756VF | Recombinant Full Length Vibrio Cholerae Serotype O1 Fumarate Reductase Subunit D(Frdd) Protein, His-Tagged | +Inquiry |
ATP13A5-2112M | Recombinant Mouse ATP13A5 Protein | +Inquiry |
SNRNP35-2847H | Recombinant Human SNRNP35, His-tagged | +Inquiry |
◆ Native Proteins | ||
TTR-131H | Native Human Prealbumin protein | +Inquiry |
Histone-53C | Native Calf Histone Protein | +Inquiry |
TSH-108H | Active Native Human Thyroid Stimulating Hormone | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
Tropomyosin/Troponin-895R | Native Rabbit Tropomyosin/Troponin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEMA4C-1979HCL | Recombinant Human SEMA4C 293 Cell Lysate | +Inquiry |
TMEM223-962HCL | Recombinant Human TMEM223 293 Cell Lysate | +Inquiry |
TMEM41A-952HCL | Recombinant Human TMEM41A 293 Cell Lysate | +Inquiry |
HDDC2-5599HCL | Recombinant Human HDDC2 293 Cell Lysate | +Inquiry |
AOC2-8823HCL | Recombinant Human AOC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All phaC Products
Required fields are marked with *
My Review for All phaC Products
Required fields are marked with *
0
Inquiry Basket