Recombinant Full Length Rhizobium Meliloti Nitrogen Fixation Protein Fixg(Fixg) Protein, His-Tagged
Cat.No. : | RFL34387RF |
Product Overview : | Recombinant Full Length Rhizobium meliloti Nitrogen fixation protein fixG(fixG) Protein (P18396) (1-524aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium Meliloti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-524) |
Form : | Lyophilized powder |
AA Sequence : | MLHQPKTKATVGRLDAETVNAARVRGPLYEKRRKIFPKRAEGRFRRFKWLVMLVTLGIYY LTPWIRWDRGAHAPDQAVLIDLASRRFYFFFIEIWPQEFFFVAGLLVMAGFGLFLVTSAV GRAWCGYACPQTVWVDLFLVVERFIEGDRNARMRLDAGPWSLDKIRKRVAKHAIWVAIGV ATGGAWIFYFADAPSLMSSLVALDAPPVAYTTIGILTATTYVFGGLMREQVCTYMCPWPR IQAAMLDENSLVVTYNDWRGEPRSRHAKKAAAAGEVVGDCVDCNACVAVCPMGIDIRDGQ QLECITCALCIDACDGVMDKLGRERGLISYATLSDYAANMALATSGGTAAIDPSRVRNAH GAFRDKVRHLNWRIVFRPRVLVYFGVWATVGFGLLFGLLARDRLELNVLHDRNPQFVVES DGSVRNGYMVKLLNMIPEQRTISLTIEGMPAATMRVAGQATGDGRRVTIGVEPDKVTPLK VFVTLPKGRFAEAEEGFSLIAEDPSSHERDVYQANFNLPGAAGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fixG |
Synonyms | fixG; RA0661; SMa1211; Nitrogen fixation protein FixG |
UniProt ID | P18396 |
◆ Recombinant Proteins | ||
SERINC4-1235H | Recombinant Human SERINC4 | +Inquiry |
PA2G4-7345H | Recombinant Human PA2G4 protein(Ser2-Asp394), His-tagged | +Inquiry |
Igfbp6-346M | Recombinant Mouse Igfbp6 Protein, His-tagged | +Inquiry |
INMT-4551M | Recombinant Mouse INMT Protein, His (Fc)-Avi-tagged | +Inquiry |
GPD2-4327Z | Recombinant Zebrafish GPD2 | +Inquiry |
◆ Native Proteins | ||
HB-41D | Native Dog Hemoglobin (HB) Protein | +Inquiry |
Thrombin-27B | Active Native Bovine alpha-Thrombin | +Inquiry |
IgG-354G | Native Guinea Pig IgG | +Inquiry |
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PINX1-3177HCL | Recombinant Human PINX1 293 Cell Lysate | +Inquiry |
KRT6C-4865HCL | Recombinant Human KRT6C 293 Cell Lysate | +Inquiry |
MRPL40-4169HCL | Recombinant Human MRPL40 293 Cell Lysate | +Inquiry |
AQP3-8767HCL | Recombinant Human AQP3 293 Cell Lysate | +Inquiry |
BCAM-1438RCL | Recombinant Rat BCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fixG Products
Required fields are marked with *
My Review for All fixG Products
Required fields are marked with *
0
Inquiry Basket