Recombinant Full Length Rhizobium Loti Protease Htpx Homolog(Htpx) Protein, His-Tagged
Cat.No. : | RFL204RF |
Product Overview : | Recombinant Full Length Rhizobium loti Protease HtpX homolog(htpX) Protein (Q98ET0) (1-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium loti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-336) |
Form : | Lyophilized powder |
AA Sequence : | MNTLRTAMLLAAMTALFMGVGFLIGGSGGMMIALLIAAGTNLFSYWNADKMVLSMNRAVE VDEKNAPEYYAIVQALAKQAGLPMPRTYLIDNPQPNAFATGRNPQNAAVAASTGLLQRLT HEEVAAVMAHELAHVQHRDTLTMTIVATFAGAISMLGNFAFFLGGNRDNNPFGFVGVLAA MIVAPFAAMIVQMAVSRTREYEADRRGAEICGHPLWLASALDKIARGAERIPNPDAERNP AMAHLFIINPLHGERMDNLFSTHPSTDNRIAALQEMAQQMAGGTQAAPRPTPRQAGEQQP SGPWGQAPQAEQPAEPERPKANPWGRNPTGPKGRWS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | htpX |
Synonyms | htpX; mlr4097; Protease HtpX homolog |
UniProt ID | Q98ET0 |
◆ Recombinant Proteins | ||
B3GALTL-926M | Recombinant Mouse B3GALTL Protein, His (Fc)-Avi-tagged | +Inquiry |
DLK2-1676H | Recombinant Human DLK2 Protein (27-306 aa), His-tagged | +Inquiry |
SRPK1-6923HF | Active Recombinant Full Length Human SRPK1 Protein, GST-tagged | +Inquiry |
FABP5-3366H | Recombinant Human FABP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CALY-3083HF | Recombinant Full Length Human CALY Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Neuraminidase-012C | Active Native Clostridium perfringens Phospholipase C, Type I | +Inquiry |
HP-200H | Native Human Haptoglobin | +Inquiry |
Hb-901M | Native Mouse Hemoglobin Protein | +Inquiry |
Fibrin-001H | Native Human Fibrin Protein | +Inquiry |
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RIC3-2341HCL | Recombinant Human RIC3 293 Cell Lysate | +Inquiry |
DCTN3-7041HCL | Recombinant Human DCTN3 293 Cell Lysate | +Inquiry |
THPO-2831MCL | Recombinant Mouse THPO cell lysate | +Inquiry |
DLX4-6904HCL | Recombinant Human DLX4 293 Cell Lysate | +Inquiry |
NCOA1-3943HCL | Recombinant Human NCOA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All htpX Products
Required fields are marked with *
My Review for All htpX Products
Required fields are marked with *
0
Inquiry Basket