Recombinant Full Length Rhizobium Etli Beta-(1-->2)Glucan Export Atp-Binding/Permease Protein Ndva(Ndva) Protein, His-Tagged
Cat.No. : | RFL30810RF |
Product Overview : | Recombinant Full Length Rhizobium etli Beta-(1-->2)glucan export ATP-binding/permease protein NdvA(ndvA) Protein (Q2K342) (1-587aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium etli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-587) |
Form : | Lyophilized powder |
AA Sequence : | MSLFKVYARALRYLGAYKLRVSLVVIANIVLATITIAEPILFGRIIDAISGKGEVKPILF MWAAFAVFNTVAFVLVSREADRLAHGRRATLLTEAFGRIISMPLAWHHQRGTSNALHTLL RACETLFGLWLEFMRNHLSTVIALALLVPTAMSMDLRLSAVLIVLGIAYWLIGRVVMSRT KDGQASVENHYHTVFSHVSDSISNVSVLHSYNRIEAETKALKSFANRLLEAQYPVLDWWA LASALNRMASTIAMMVVLIIGTMLVQSGELRIGDVIAFIGFANLLIARLDLMRQFATQIF EARSKLEDFYTLEDSVRDREEPAGNGEIKNVKGAIEFRDVSFGFGNSSQGLHNVSFSVKA GQTVAIVGPTGAGKTTLVNLLQRVYDPQGGQILVDGTDITKVTRKSLRRHIATVFQDAGL LNRSISDNIRLGREGASEEDMRRAAEAAAAADFIETREDRYDTHVGERGNKLSGGERQRI AIARAILKDAPILVLDEATSALDVETEARVKAAIDNLRQNRTTFIIAHRLSTVREADMVL FLDDGRVVEQGGFDELSHSNGRFAALLRASGILTDEEVRKAHTTEAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndvA |
Synonyms | ndvA; RHE_CH04000; Beta-(1-->2glucan export ATP-binding/permease protein NdvA |
UniProt ID | Q2K342 |
◆ Recombinant Proteins | ||
Rgs20-5497M | Recombinant Mouse Rgs20 Protein, Myc/DDK-tagged | +Inquiry |
TTC1-9709M | Recombinant Mouse TTC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCSK9-3334R | Recombinant Rhesus monkey PCSK9 Protein, His-tagged | +Inquiry |
AGRP-535H | Recombinant Human AGRP Protein, MYC/DDK-tagged | +Inquiry |
NTF3-011H | Active Recombinant Human NTF3(139-257aa) | +Inquiry |
◆ Native Proteins | ||
C4A-2H | Native Human Complement C4 | +Inquiry |
Collagen Type IV-09H | Native Human Collagen Type IV | +Inquiry |
Lectin-1775E | Active Native Erythrina Cristagalli Lectin Protein | +Inquiry |
CDA002 | Active Native Human MUC16 Protein | +Inquiry |
CSH1-31024TH | Native Human CSH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUFU-1362HCL | Recombinant Human SUFU 293 Cell Lysate | +Inquiry |
FAM124B-6439HCL | Recombinant Human FAM124B 293 Cell Lysate | +Inquiry |
LAYN-2896HCL | Recombinant Human LAYN cell lysate | +Inquiry |
OS9-3545HCL | Recombinant Human OS9 293 Cell Lysate | +Inquiry |
EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndvA Products
Required fields are marked with *
My Review for All ndvA Products
Required fields are marked with *
0
Inquiry Basket