Recombinant Full Length Rat Vitamin K Epoxide Reductase Complex Subunit 1-Like Protein 1(Vkorc1L1) Protein, His-Tagged
Cat.No. : | RFL17305RF |
Product Overview : | Recombinant Full Length Rat Vitamin K epoxide reductase complex subunit 1-like protein 1(Vkorc1l1) Protein (Q6TEK3) (1-176aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-176) |
Form : | Lyophilized powder |
AA Sequence : | MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALVLMTSSIVS VVGSLYLAYILYFVLKEFCIICVTTYVLNFLLLIINYKRLVYLNEAWKRQLQPKED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Vkorc1l1 |
Synonyms | Vkorc1l1; Vitamin K epoxide reductase complex subunit 1-like protein 1; VKORC1-like protein 1 |
UniProt ID | Q6TEK3 |
◆ Recombinant Proteins | ||
VKORC1L1-3664H | Recombinant Human VKORC1L1, GST-tagged | +Inquiry |
RFL15396HF | Recombinant Full Length Human Vitamin K Epoxide Reductase Complex Subunit 1-Like Protein 1(Vkorc1L1) Protein, His-Tagged | +Inquiry |
VKORC1L1-5161R | Recombinant Rhesus monkey VKORC1L1 Protein, His-tagged | +Inquiry |
VKORC1L1-6182R | Recombinant Rat VKORC1L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VKORC1L1-4974R | Recombinant Rhesus Macaque VKORC1L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VKORC1L1-404HCL | Recombinant Human VKORC1L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Vkorc1l1 Products
Required fields are marked with *
My Review for All Vkorc1l1 Products
Required fields are marked with *
0
Inquiry Basket