Recombinant Full Length Rat Vacuole Membrane Protein 1(Vmp1) Protein, His-Tagged
Cat.No. : | RFL32467RF |
Product Overview : | Recombinant Full Length Rat Vacuole membrane protein 1(Vmp1) Protein (Q91ZQ0) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MAENGTNCDQRRGAMSKEQHNGSFTDPSSVNEKKRRDREERQNIVLWRQPLITLQYFSLE TLVVLKEWTSKLWHRQSMVVSFFLLLAALVATYYVEGAHQQYVQRIEKQFLLYAYWIGLG ILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGAISL WSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAETAQDF ASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKIFVIVTFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHRSEAGTAQG ENWLSWTFEKLVVAMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Vmp1 |
Synonyms | Vmp1; Vacuole membrane protein 1 |
UniProt ID | Q91ZQ0 |
◆ Recombinant Proteins | ||
MYSM1-5903H | Recombinant Human MYSM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Arhgap17-1680M | Recombinant Mouse Arhgap17 Protein, Myc/DDK-tagged | +Inquiry |
RNF13-5069R | Recombinant Rat RNF13 Protein | +Inquiry |
Il7-174R | Recombinant Rat Interleukin 7 | +Inquiry |
FGF2-5403H | Recombinant Human FGF2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
TF-391H | Native Human Transferrin | +Inquiry |
LHB-8212H | Native Luteinizing Beta Subunit Hormone | +Inquiry |
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RDM1-2434HCL | Recombinant Human RDM1 293 Cell Lysate | +Inquiry |
TERF2-1146HCL | Recombinant Human TERF2 293 Cell Lysate | +Inquiry |
TMEM126A-1008HCL | Recombinant Human TMEM126A 293 Cell Lysate | +Inquiry |
TMEM38A-954HCL | Recombinant Human TMEM38A 293 Cell Lysate | +Inquiry |
GDPD1-291HCL | Recombinant Human GDPD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Vmp1 Products
Required fields are marked with *
My Review for All Vmp1 Products
Required fields are marked with *
0
Inquiry Basket