Recombinant Full Length Rat Udp-Glucuronosyltransferase 1-1(Ugt1A1) Protein, His-Tagged
Cat.No. : | RFL28186RF |
Product Overview : | Recombinant Full Length Rat UDP-glucuronosyltransferase 1-1(Ugt1a1) Protein (Q64550) (30-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (30-535) |
Form : | Lyophilized powder |
AA Sequence : | GKLLVIPIDGSHWLSMLGVIQQLQQKGHEVVVIAPEASIHIKEGSFYTMRKYPVPFQNEN VTAAFVELGRSVFDQDPFLLRVVKTYNKVKRDSSMLLSGCSHLLHNAEFMASLEQSHFDA LLTDPFLPCGSIVAQYLSLPAVYFLNALPCSLDLEATQCPAPLSYVPKSLSSNTDRMNFL QRVKNMIIALTENFLCRVVYSPYGSLATEILQKEVTVKDLLSPASIWLMRNDFVKDYPRP IMPNMVFIGGINCLQKKALSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALG RIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVP MVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLH KDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVY KSCAYGCRKCFGGKGRVKKSHKSKTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ugt1a1 |
Synonyms | Ugt1a1; Ugt1; UDP-glucuronosyltransferase 1A1; UGT1A1; B1; UDP-glucuronosyltransferase 1-1; UDPGT 1-1; UGT1*1; UGT1-01; UGT1.1 |
UniProt ID | Q64550 |
◆ Recombinant Proteins | ||
UGT1A1-1019H | Recombinant Human UGT1A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UGT1A1-1927HFL | Recombinant Full Length Human UGT1A1, Flag-tagged | +Inquiry |
UGT1A1-17804M | Recombinant Mouse UGT1A1 Protein | +Inquiry |
UGT1A1-4912R | Recombinant Rhesus Macaque UGT1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ugt1a1-535R | Recombinant Rat Ugt1a1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UGT1A1-513HCL | Recombinant Human UGT1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ugt1a1 Products
Required fields are marked with *
My Review for All Ugt1a1 Products
Required fields are marked with *
0
Inquiry Basket