Recombinant Full Length Rat Proteolipid Protein 2(Plp2) Protein, His-Tagged
Cat.No. : | RFL6787RF |
Product Overview : | Recombinant Full Length Rat Proteolipid protein 2(Plp2) Protein (Q6P742) (1-151aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-151) |
Form : | Lyophilized powder |
AA Sequence : | MADSERLSAPGCWLACTSFSRTKKGILLFAEIILCLVILICFSASTSAYSSLSVIEMIFA AVLFVFYMCDLHSKISFINWPWTDFFRSLIAAILYLITSIVVLVEGRGSSKIVAGVLGLL ATLLFGYDAYITFPLKQQRHTAAPTDPTDGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Plp2 |
Synonyms | Plp2; Proteolipid protein 2 |
UniProt ID | Q6P742 |
◆ Recombinant Proteins | ||
PDGFRA-825HAF555 | Recombinant Human PDGFRA Protein, DDDDK-tagged, Alexa Fluor 555 conjugated | +Inquiry |
PRPS1-557C | Recombinant Cynomolgus Monkey PRPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL480SF | Recombinant Full Length Synechococcus Sp. Proton Extrusion Protein Pcxa(Pcxa) Protein, His-Tagged | +Inquiry |
VPS72-18386M | Recombinant Mouse VPS72 Protein | +Inquiry |
FGF17-170H | Recombinant Human FGF17 protein | +Inquiry |
◆ Native Proteins | ||
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
PLE-172P | Active Native Porcine Esterase | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
KRT19-40H | Native Human KRT19 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIF1AN-5564HCL | Recombinant Human HIF1AN 293 Cell Lysate | +Inquiry |
PDE5A-3348HCL | Recombinant Human PDE5A 293 Cell Lysate | +Inquiry |
SOHLH1-1572HCL | Recombinant Human SOHLH1 293 Cell Lysate | +Inquiry |
SSX3-1447HCL | Recombinant Human SSX3 293 Cell Lysate | +Inquiry |
C9orf24-7935HCL | Recombinant Human C9orf24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Plp2 Products
Required fields are marked with *
My Review for All Plp2 Products
Required fields are marked with *
0
Inquiry Basket