Recombinant Full Length Rat Protein Fam26F(Fam26F) Protein, His-Tagged
Cat.No. : | RFL36593RF |
Product Overview : | Recombinant Full Length Rat Protein FAM26F(Fam26f) Protein (Q561R8) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MEKFKAVLDLQIKHRSALGYGLVTLLTAGGEKIFSTVVFQCPCTATLNLTYGLVFLLVPA LALFLLGYALSARTWRLLTGCCSRSASTRSSSGLRSTLVCAQVSAVAALAPLTWVAVALL GGSFYQCAVSGSTRLASYLCKDRNHSCIAKLPQVPCNKQEAEMQEILSQLKAQSQVLGWV LIAAVIFLLLVFKCVSRCFSPVSYLQLKFWEIYLEKEKQILQSQAAEHATQLARENIRSF FECSKPKECNTPSRKDWQQISALYTFNSKNQFYSMLHKYVSRKEVSSSLHSVEGDVVVPV LGFVDDAAMANTHGV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Calhm6 |
Synonyms | Calhm6; Fam26f; Calcium homeostasis modulator protein 6; Protein FAM26F |
UniProt ID | Q561R8 |
◆ Recombinant Proteins | ||
EXOC3-4320H | Recombinant Human EXOC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRPSAP1-1777H | Recombinant Human PRPSAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCND1-0658H | Recombinant Human CCND1 Protein, GST-Tagged | +Inquiry |
AYP1020-RS00880-5161S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS00880 protein, His-tagged | +Inquiry |
TMEM121-6108C | Recombinant Chicken TMEM121 | +Inquiry |
◆ Native Proteins | ||
B. garinii-22 | Native Borrelia garinii Antigen | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
F2-5401B | Native Bovine Coagulation Factor II (thrombin) | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFS2-3897HCL | Recombinant Human NDUFS2 293 Cell Lysate | +Inquiry |
CCDC42-156HCL | Recombinant Human CCDC42 lysate | +Inquiry |
PCSK2-3371HCL | Recombinant Human PCSK2 293 Cell Lysate | +Inquiry |
HA-2605ICL | Recombinant Influenza B HA cell lysate | +Inquiry |
SZT2-905HCL | Recombinant Human SZT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Calhm6 Products
Required fields are marked with *
My Review for All Calhm6 Products
Required fields are marked with *
0
Inquiry Basket