Recombinant Full Length Rat Probable G-Protein Coupled Receptor 19(Gpr19) Protein, His-Tagged
Cat.No. : | RFL22539RF |
Product Overview : | Recombinant Full Length Rat Probable G-protein coupled receptor 19(Gpr19) Protein (P70585) (1-415aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-415) |
Form : | Lyophilized powder |
AA Sequence : | MGFDHRMETDQPPVVTATLLVPLQNGSCVEAAEALLPHGLMELHEEHSWMSNRTDLQYEL NPGEVATASIFFGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTP FVVLQFTTGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKA KRMIAASWILDAAFVTPVFFFYGSNWDSHCNYFLPPSWEGTAYTVIHFLVGFVIPSVLII LFYQKVIKYIWRIGTDGRTLRRTMNIVPRTKVKTVKMFLLLNLVFLFSWLPFHVAQLWHP HEQDYRKSSLVFTAVTWVSFSSSASKPTLYSIYNANFRRGMKETFCMSSMKCYRSNAYTI TTSSRMAKRNYVGISEIPPVSRTITKDSIYDSFDREAREKKLAWPINSNPPNTFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr19 |
Synonyms | Gpr19; Probable G-protein coupled receptor 19 |
UniProt ID | P70585 |
◆ Native Proteins | ||
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
IgG-335G | Native GOAT Gamma Globulin Fraction | +Inquiry |
LYPL-29 | Active Native Lysophospholipase | +Inquiry |
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
CELA1-52P | Active Native Porcine pancreatic elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cerebellum-67H | Human Cerebellum (RT) Membrane Lysate | +Inquiry |
ATP6V1D-50HCL | Recombinant Human ATP6V1D lysate | +Inquiry |
C19orf60-93HCL | Recombinant Human C19orf60 lysate | +Inquiry |
Fetus-187M | Mouse Fetus (17 Day Fetus) Lysate | +Inquiry |
ZNF362-87HCL | Recombinant Human ZNF362 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gpr19 Products
Required fields are marked with *
My Review for All Gpr19 Products
Required fields are marked with *
0
Inquiry Basket