Recombinant Full Length Rat Parathyroid Hormone 2 Receptor(Pth2R) Protein, His-Tagged
Cat.No. : | RFL10963RF |
Product Overview : | Recombinant Full Length Rat Parathyroid hormone 2 receptor(Pth2r) Protein (P70555) (25-546aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-546) |
Form : | Lyophilized powder |
AA Sequence : | QLDSDGTITIEEQIVLVMKAKMQCELNITAQFQEGEGNCFPEWDGLICWPRGTAGKTSAM PCPSYVYDFNHKGVAFRHCTPNGTWDFIHGSNKTWANYSDCFLQPDINIGKQEFFENLYI LYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHLHLFVSFMLRAXSIFVKDRVAQAHLG VEALQSLVMQGDLQNFIGGPSVDKSQYVGCKIAVVMFIYFLATNYYWILVEGLYLHNLIF VSFFSDTKYLWGFILIGWGFPAVFVVAWAVARATLADTRCWELSAGDRWIYXXPILAAIG LNFILFLNTVRVLATKIWETNAVGHDMRKQYRKLAKSTLVLVLVFGVHYIVFICQPHSFS GLWWEIRMHCELFFNSFQGFFVSIVYCYCNGEVQAEVKKTWTRWNLSIDWKKAPPCGGHR YGSVLTTVTHSTSSQSQMGPSTRLVLISSKPAKTACRQIDSHVTLPGYVWSSSEQDCQPQ STPEETKKGHGRQEDDSPVGESSRPVAFTIDTEGCKGESHPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pth2r |
Synonyms | Pth2r; Pthr2; Parathyroid hormone 2 receptor; PTH2 receptor |
UniProt ID | P70555 |
◆ Recombinant Proteins | ||
TIMP3-4492H | Recombinant Human TIMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRY2-5566A | Recombinant Mouse-ear cress CRY2 Protein (Met1-Lys612), N-His tagged | +Inquiry |
CASP6-601H | Recombinant Human Caspase 6, Apoptosis-related Cysteine Peptidase | +Inquiry |
GZF1-4515H | Recombinant Human GZF1 Protein, GST-tagged | +Inquiry |
ZNF259-6943H | Recombinant Human Zinc Finger Protein 259, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1796L | Active Native Lotus Tetragonolobus Lectin Protein, Agarose bound | +Inquiry |
Lectin-1777G | Active Native Galanthus Nivalis Lectin Protein, Biotinylated | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
Lectin-1721P | Native Peanut Lectin | +Inquiry |
Pepsin-27H | Native Human Pepsin (PP) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTM1-4078HCL | Recombinant Human MTM1 293 Cell Lysate | +Inquiry |
HA-2364HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
SELT-1982HCL | Recombinant Human SELT 293 Cell Lysate | +Inquiry |
TUBA3FP-1089HCL | Recombinant Human TUBA3FP cell lysate | +Inquiry |
MOBKL2A-4265HCL | Recombinant Human MOBKL2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Pth2r Products
Required fields are marked with *
My Review for All Pth2r Products
Required fields are marked with *
0
Inquiry Basket