Recombinant Full Length Rat Neuromedin-K Receptor(Tacr3) Protein, His-Tagged
Cat.No. : | RFL8465RF |
Product Overview : | Recombinant Full Length Rat Neuromedin-K receptor(Tacr3) Protein (P16177) (1-452aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-452) |
Form : | Lyophilized powder |
AA Sequence : | MASVPRGENWTDGTVEVGTHTGNLSSALGVTEWLALQAGNFSSALGLPATTQAPSQVRAN LTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDAS VAAFNTLINFIYGLHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKP RLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVII LVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWL PYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRW CPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVLFDPNDGDPTKSSRKKRAVPRD PSANGCSHRGSKSASTTSSFISSPYTSVDEYS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tacr3 |
Synonyms | Tacr3; Tac3r; Neuromedin-K receptor; NKR; NK-3 receptor; NK-3R; Neurokinin B receptor; Tachykinin receptor 3 |
UniProt ID | P16177 |
◆ Recombinant Proteins | ||
LETM2-9057M | Recombinant Mouse LETM2 Protein | +Inquiry |
ZNF346-5203Z | Recombinant Zebrafish ZNF346 | +Inquiry |
SAP019A-017-1947S | Recombinant Staphylococcus aureus (strain: NRS104) SAP019A_017 protein, His-tagged | +Inquiry |
SPAG1-5338R | Recombinant Rat SPAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OR56A1-1695H | Recombinant Human OR56A1 | +Inquiry |
◆ Native Proteins | ||
Protein Z-91H | Native Human Protein Z | +Inquiry |
Artery-015H | Human Artery Lysate, Total Protein | +Inquiry |
B. pertussis-36 | Native B. pertussis Filamentous Hemagglutinin Antigen | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
Adipose Tissue-001H | Human Adipose Tissue Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF20-6243HCL | Recombinant Human FGF20 293 Cell Lysate | +Inquiry |
FAM53B-266HCL | Recombinant Human FAM53B lysate | +Inquiry |
GTF2B-5703HCL | Recombinant Human GTF2B 293 Cell Lysate | +Inquiry |
Lung-755B | Bovine Lung Membrane Lysate, Total Protein | +Inquiry |
CLDN1-7471HCL | Recombinant Human CLDN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tacr3 Products
Required fields are marked with *
My Review for All Tacr3 Products
Required fields are marked with *
0
Inquiry Basket