Recombinant Full Length Rat Lipid Phosphate Phosphohydrolase 2(Ppap2C) Protein, His-Tagged
Cat.No. : | RFL36389RF |
Product Overview : | Recombinant Full Length Rat Lipid phosphate phosphohydrolase 2(Ppap2c) Protein (Q8K593) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV IITATVVLVSSGEAYLVYTDRLYSRSDFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPSFLAVCDPDWSRVNCSGYVQVEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLAL YVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDNKHHWSDVLVGLLQGALVACLTVC YVSDFFKSRPPQSCQENEESERKPSLSLTLTLGDRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Plpp2 |
Synonyms | Plpp2; Lpp2; Ppap2c; Phospholipid phosphatase 2; Lipid phosphate phosphohydrolase 2; PAP2-gamma; PAP2-G; Phosphatidate phosphohydrolase type 2c; Phosphatidic acid phosphatase 2c; PAP-2c; PAP2c |
UniProt ID | Q8K593 |
◆ Recombinant Proteins | ||
PRDX1-5736H | Recombinant Human PRDX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PYGO2-6686H | Recombinant Human PYGO2 Protein (Leu171-Gly406), N-His tagged | +Inquiry |
FBN2-3135M | Recombinant Mouse FBN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED18-65H | Recombinant Human MED18 protein, His-tagged | +Inquiry |
IGSF11-2670R | Recombinant Rat IGSF11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HDL-201H | Native Human High Density Lipoprotein | +Inquiry |
FGG -32B | Native Bovine Fibrinogen | +Inquiry |
C3-365H | Active Native Human C3 Protein | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
IgG-019R | Native Rat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRMT11-757HCL | Recombinant Human TRMT11 293 Cell Lysate | +Inquiry |
FAM98A-591HCL | Recombinant Human FAM98A cell lysate | +Inquiry |
TBX5-1198HCL | Recombinant Human TBX5 293 Cell Lysate | +Inquiry |
HA-008H7N9HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
PRG2-2872HCL | Recombinant Human PRG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Plpp2 Products
Required fields are marked with *
My Review for All Plpp2 Products
Required fields are marked with *
0
Inquiry Basket