Recombinant Full Length Rat Epoxide Hydrolase 1(Ephx1) Protein, His-Tagged
Cat.No. : | RFL33020RF |
Product Overview : | Recombinant Full Length Rat Epoxide hydrolase 1(Ephx1) Protein (P07687) (1-455aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-455) |
Form : | Lyophilized powder |
AA Sequence : | MWLELVLASLLGFVIYWFVSRDKEETLPLGDGWWGPGSKPSAKEDESIRPFKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSNYMKKVVSYWRNEFDWRKQVEILNQYPHFKTKIEGLDIHFIHVKPPQLPSGRTPKPLLMVHGWPGSFYEFYKIIPLLTDPKSHGLSDEHVFEVICPSIPGYGYSEASSKKGLNSVATARIFYKLMTRLGFQKFYIQGGDWGSLICTNMAQMVPNHVKGLHLNMAFISRSFYTMTPLLGQRFGRFLGYTEKDIELLYPYKEKVFYSIMRESGYLHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELEDGGLERKFSLDDLLVNIMIYWTTGTIVSSQRYYKENLGQGIMVHKHEGMKVFVPTGFSAFPSELLHAPEKWVKVKYPKLISYSYMERGGHFAAFEEPKLLAQDIRKFVSLAELQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ephx1 |
Synonyms | Ephx1; Eph-1; Epoxide hydrolase 1; Epoxide hydratase; Microsomal epoxide hydrolase; mEH |
UniProt ID | P07687 |
◆ Recombinant Proteins | ||
EPHX1-1311R | Recombinant Rhesus Macaque EPHX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPHX1-1486R | Recombinant Rhesus monkey EPHX1 Protein, His-tagged | +Inquiry |
EPHX1-2857H | Recombinant Human EPHX1 protein, His-tagged | +Inquiry |
EPHX1-5252M | Recombinant Mouse EPHX1 Protein | +Inquiry |
EPHX1-463H | Recombinant Human epoxide hydrolase 1, microsomal (xenobiotic), T7 tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHX1-6586HCL | Recombinant Human EPHX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ephx1 Products
Required fields are marked with *
My Review for All Ephx1 Products
Required fields are marked with *
0
Inquiry Basket