Recombinant Full Length Rat Ddb1- And Cul4-Associated Factor 17(Dcaf17) Protein, His-Tagged
Cat.No. : | RFL450RF |
Product Overview : | Recombinant Full Length Rat DDB1- and CUL4-associated factor 17(Dcaf17) Protein (B1H299) (1-505aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-505) |
Form : | Lyophilized powder |
AA Sequence : | MGRTRKANVCPRLSRRALGFYTRDAGVVQRTNLGILRALVCQESTKFKNVWTTHSKSPIA YERGRIYFDNYRCCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGEILPDPSDYKSS LIALTAHNWLLRISATTGEILEKIYLASYCKFRYLSWDTPQEVIAVKSAQNKGSAAARQA GTQPPVLLYLAVFRVLPFSLVGILEINRKVFENVTDATLSHGILIVMYSSGLVRLYSFQA IIEQFMQQKLDLGCACSQGGTTGTVGEAPFGIPCNVKITDSPPPLFEVSSLENAFQIGGH PWHYIITPNKKKQKGVFHICALKDNSLAKNGIQEMECCSLESDWIYFHPDASGRIIHVGP NQVKVLKLSEVENNSSQHQISEDFVIWANREDRKENLITVTASGRVVKRNVNLLDDDPEQ ETFKVVDYEDELNLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVVCITTGT LSCKGFLYKRHLLGHVLVSPDSPVP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Dcaf17 |
Synonyms | Dcaf17; DDB1- and CUL4-associated factor 17 |
UniProt ID | B1H299 |
◆ Recombinant Proteins | ||
DCAF17-1445R | Recombinant Rat DCAF17 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33212MF | Recombinant Full Length Mouse Ddb1- And Cul4-Associated Factor 17(Dcaf17) Protein, His-Tagged | +Inquiry |
DCAF17-7281Z | Recombinant Zebrafish DCAF17 | +Inquiry |
RFL9922HF | Recombinant Full Length Human Ddb1- And Cul4-Associated Factor 17(Dcaf17) Protein, His-Tagged | +Inquiry |
DCAF17-4336M | Recombinant Mouse DCAF17 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Dcaf17 Products
Required fields are marked with *
My Review for All Dcaf17 Products
Required fields are marked with *
0
Inquiry Basket