Recombinant Full Length Rat Alpha-1D Adrenergic Receptor(Adra1D) Protein, His-Tagged
Cat.No. : | RFL-14647RF |
Product Overview : | Recombinant Full Length Rat Alpha-1D adrenergic receptor(Adra1d) Protein (P23944) (1-561aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-561) |
Form : | Lyophilized powder |
AA Sequence : | MTFRDILSVTFEGPRSSSSTGGSGAGGGAGTVGPEGGAVGGVPGATGGGAVVGTGSGEDN QSSTGEPGAAASGEVNGSAAVGGLVVSAQGVGVGVFLAAFILTAVAGNLLVILSVACNRH LQTVTNYFIVNLAVADLLLSAAVLPFSATMEVLGFWAFGRTFCDVWAAVDVLCCTASILS LCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWAVALVVSVGPLLGWKEPVPPDERFC GITEEVGYAIFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGIKREPGKASEVVLRI HCRGAATSAKGYPGTQSSKGHTLRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFF VLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRR RLWAVYGHHWRASTGDARSDCAPSPRIAPPGAPLALTAHPGAGSADTPETQDSVSSSRKP ASALREWRLLGPLQRPTTQLRAKVSSLSHKIRSGARRAETACALRSEVEAVSLNVPQDGA EAVICQAYEPGDYSNLRETDI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Adra1d |
Synonyms | Adra1d; Adra1a; Alpha-1D adrenergic receptor; Alpha-1A adrenergic receptor; Alpha-1D adrenoreceptor; Alpha-1D adrenoceptor; RA42 |
UniProt ID | P23944 |
◆ Recombinant Proteins | ||
Edar-1721M | Recombinant Mouse Ectodysplasin-A Receptor | +Inquiry |
CCR3-10884H | Recombinant Human CCR3, GST-tagged | +Inquiry |
TNFSF14-29950TH | Recombinant Human TNFSF14 | +Inquiry |
FAM104A-2410C | Recombinant Chicken FAM104A | +Inquiry |
SAP048A-024-4512S | Recombinant Staphylococcus aureus (strain: NE 3809) SAP048A_024 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MB-01B | Native Bovine MB Protein | +Inquiry |
A2m-367M | Native Mouse Alpha-2-Macroglobulin | +Inquiry |
AZU1-40H | Native Human Azurocidin | +Inquiry |
HB-41D | Native Dog Hemoglobin (HB) Protein | +Inquiry |
Hyaluronidase-34O | Active Native Ovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIR-3168HCL | Recombinant Human PIR 293 Cell Lysate | +Inquiry |
RNF5-549HCL | Recombinant Human RNF5 lysate | +Inquiry |
Thyroid-449S | Sheep Thyroid Lysate, Total Protein | +Inquiry |
HMGCLL1-5474HCL | Recombinant Human HMGCLL1 293 Cell Lysate | +Inquiry |
RWDD1-1552HCL | Recombinant Human RWDD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Adra1d Products
Required fields are marked with *
My Review for All Adra1d Products
Required fields are marked with *
0
Inquiry Basket