Recombinant Full Length Ranunculus Macranthus Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic Protein, His-Tagged
Cat.No. : | RFL24974RF |
Product Overview : | Recombinant Full Length Ranunculus macranthus NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic Protein (A1XGT6) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ranunculus macranthus (Large buttercup) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTKLQAINSFYRSESLKEVYGLVWLLIPIFILVLGIVIGVLVIVWLERQISAGVQQ RIGPEYAGPLGILQALADGTKLLFKEDLLPSRGDIYLFSIGPSIAVIAILLSYLVIPFGY HLVLADLSIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTPCVL SISLLSNSSSTVDIVEAQAKYGFWGWNLWRQPIGFTVFFISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPHILIPELFGINEMGGV FGMTIGIFITLAKAYLFLFISITTRWTLPRMRMDQLLNLGWKFLLPISLGNLLLTTSFQL FSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | A1XGT6 |
◆ Recombinant Proteins | ||
RFL3302WF | Recombinant Full Length Welwitschia Mirabilis Photosystem Ii Reaction Center Protein Z(Psbz) Protein, His-Tagged | +Inquiry |
MAPK12-30H | Recombinant human biotinylated MAPK12, His-tagged | +Inquiry |
FAM71E1-4633HF | Recombinant Full Length Human FAM71E1 Protein, GST-tagged | +Inquiry |
NFATC3-27538TH | Recombinant Human NFATC3 | +Inquiry |
SETD7-186H | Recombinant Human SETD7 Protein, His/GST-tagged | +Inquiry |
◆ Native Proteins | ||
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
IgA-243C | Native Cat Immunoglobulin A | +Inquiry |
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
CA242-161H | Active Native Human Cancer Antigen 242 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF34-91HCL | Recombinant Human ZNF34 293 Cell Lysate | +Inquiry |
OIP5-3588HCL | Recombinant Human OIP5 293 Cell Lysate | +Inquiry |
KCNA2-5077HCL | Recombinant Human KCNA2 293 Cell Lysate | +Inquiry |
SULT1C2-1351HCL | Recombinant Human SULT1C2 293 Cell Lysate | +Inquiry |
ARSK-8673HCL | Recombinant Human ARSK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket