Recombinant Full Length Ralstonia Solanacearum Sulfoxide Reductase Heme-Binding Subunit Yedz(Yedz) Protein, His-Tagged
Cat.No. : | RFL36815RF |
Product Overview : | Recombinant Full Length Ralstonia solanacearum Sulfoxide reductase heme-binding subunit YedZ(yedZ) Protein (Q8XV51) (1-217aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ralstonia solanacearum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-217) |
Form : | Lyophilized powder |
AA Sequence : | MLPSMLPPKSLRAVRIAVWLLALVPFLRLVVLGATDRYGANPLEFVTRSTGTWTLVLLCC TLAVTPLRRLTGMNWLIRIRRMLGLYTFFYGTLHFLIWLLVDRGLDPASMVKDIAKRPFI TVGFAAFVLMIPLAATSTNAMVRRLGGRRWQWLHRLVYVTGVLGILHYWWHKAGKHDFAE VSIYAAVMAVLLGLRVWWVWRGARQGAIAGGAVPLRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msrQ |
Synonyms | msrQ; RSc2980; RS01266; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ |
UniProt ID | Q8XV51 |
◆ Recombinant Proteins | ||
Il15-01M | Active Recombinant Mouse Il15 Protein, His-Tagged | +Inquiry |
ARID3B-1136HF | Recombinant Full Length Human ARID3B Protein, GST-tagged | +Inquiry |
LMAN2L-9145M | Recombinant Mouse LMAN2L Protein | +Inquiry |
MRAP-6341HF | Recombinant Full Length Human MRAP Protein, GST-tagged | +Inquiry |
Serpina1a-3309M | Recombinant Mouse Serpina1a, His-tagged | +Inquiry |
◆ Native Proteins | ||
MB-236B | Native Bovine Myoglobin | +Inquiry |
HBA1-5284H | Native Human Hemoglobin, Alpha 1 | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
XOD-22B | Native Bovine XOD Protein | +Inquiry |
Lectin-1751A | Active Native Aleuria Aurantia Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRA5-1359RCL | Recombinant Rat LILRA5 cell lysate | +Inquiry |
NUAK1-3665HCL | Recombinant Human NUAK1 293 Cell Lysate | +Inquiry |
C3orf39-8044HCL | Recombinant Human C3orf39 293 Cell Lysate | +Inquiry |
MRPL17-4192HCL | Recombinant Human MRPL17 293 Cell Lysate | +Inquiry |
PLAUR-1888HCL | Recombinant Human PLAUR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msrQ Products
Required fields are marked with *
My Review for All msrQ Products
Required fields are marked with *
0
Inquiry Basket