Recombinant Full Length Ralstonia Solanacearum Putative Tyrosine-Protein Kinase Epsb(Epsb) Protein, His-Tagged
Cat.No. : | RFL26910RF |
Product Overview : | Recombinant Full Length Ralstonia solanacearum Putative tyrosine-protein kinase epsB(epsB) Protein (Q45409) (1-750aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ralstonia solanacearum (Pseudomonas solanacearum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-750) |
Form : | Lyophilized powder |
AA Sequence : | MTQNLPQPPAVNAPENELDLVRYLDVLVANRWLIAGIAAAVMLLGAAYAFLARPVYEADI MVQVEDNPNSAKSLLGDVSSLFDVKTDANAEIEILRSRMVVGKAVDNLHLYITAKPRYFP LIGAWISSRATRLSEPGLFGLGGYVWGTESIDVDGFDVPEALEGQPFKLIVLGNGRYRLE NKSLDAPIEGVVGEPLEAKQSIGTIQLQVNNLTAKAGATFELERDSRLKTMEMLQDKLKI AEKGKQSGIIGASLDGTNPALTAAIMNQIATEYVAQNIKRKAEEAERSLVFLDGLLPQLK LELERAEMKYNEMRNLRGTFDLSEEGKAFLQESVTVETSLQELKQKRAELLTRFTSSHPG VQAIDQQISVMSGKVNSMTRRLKSLPNIEQDTVRLMRDVQVDNELYVSLLNDMQQLKLVK AGKVGNVRLVDGAAVPEEPVKPKKLTVTPLAGVLGVVLGVMAAFVRNALFGGITDPQDIE EHTGLSVYATVPLSDTQVDLSGQLTTRKRGQYLLARRVPDDPSIEALRSLRTALQFAMQD AGNNLVVLTGPTPGVGKSFVSANLAAVIATGGKRVLLIDADMRKGYLHQYFGKDRKPGLL DLLAGNRSIEQVVHREVVPGLDFIATGLFPHNPSELLLNPRMVELMDTFRSQYDLVLVDT PPVLAVADTAILAARAGLVLLVTRFERSTLGEIRETIKQLQHANVDVRGVVFNALDPNTY RYGYGSRYGRYRYVQYGYTSNSKPPEAESA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | epsB |
Synonyms | epsB; Putative tyrosine-protein kinase EpsB; EPS I polysaccharide export protein EpsB |
UniProt ID | Q45409 |
◆ Recombinant Proteins | ||
CHRNA2A-3759Z | Recombinant Zebrafish CHRNA2A | +Inquiry |
DBN1-1781R | Recombinant Rat DBN1 Protein | +Inquiry |
RFL5142EF | Recombinant Full Length Escherichia Coli Inner Membrane Protein Yfez(Yfez) Protein, His-Tagged | +Inquiry |
KCNK4-4748M | Recombinant Mouse KCNK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2682HF | Recombinant Full Length Haemophilus Influenzae Upf0114 Protein Hi_0507 (Hi_0507) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
Lectin-1813P | Active Native Peanut Lectin Protein, Biotinylated | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
TNC-08H | Native Human TNC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUMO1-1344HCL | Recombinant Human SUMO1 293 Cell Lysate | +Inquiry |
Rectum-419H | Human Rectum Membrane Lysate | +Inquiry |
MPPED1-4227HCL | Recombinant Human MPPED1 293 Cell Lysate | +Inquiry |
CAMK2G-7876HCL | Recombinant Human CAMK2G 293 Cell Lysate | +Inquiry |
KIF18A-4952HCL | Recombinant Human KIF18A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All epsB Products
Required fields are marked with *
My Review for All epsB Products
Required fields are marked with *
0
Inquiry Basket