Recombinant Full Length Rabbit Udp-Glucuronosyltransferase 2C1(Ugt2C1) Protein, His-Tagged
Cat.No. : | RFL8148OF |
Product Overview : | Recombinant Full Length Rabbit UDP-glucuronosyltransferase 2C1(UGT2C1) Protein (P36514) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus (Rabbit) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | AAAMDFSHWINLKVILEELQLRGHEITVLVPSPSLLLDHTKIPFNVEVLQLQVTKETLME ELNTVLYMSSFELPTLSWWKVLGKMVEMGKQFSKNLRRVCDSAITNKELLDRLKAAKFDI CLADPLAFCGELVAELLNIPFVYSFRFSIGNIIERSCAGLPTPSSYVPGSTSGLTDNMSF VQRLKNWLLYLMNDMMFSHFMLSEWDEYYSKVLGRRTTICEIMGKAEMWLIRSYWDFEFP RPFLPNFEYVGGLHCKPAKPLPEELEEFVQSSGNDGVVVFTLGSMIQNLTEERSNLIASA LAQIPQKVLWRYTGKKPATLGPNTRLFEWIPQNDLLGHPKTRAFITHGGTNGLYEAIYHG VPMVGIPLFGDQPDNIARVKAKGAAVDVDLRIMTTSSLLKALKDVINNPSYKENAMKLSR IHHDQPLKPLDRAVFWIEFVMRHKGARHLRVAAHDLTWFQYYSLDVVVFLLTCVATIIFL AKKCCLFFYRRFCKTGNKRKRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UGT2C1 |
Synonyms | UGT2C1; UGT2A2; UDP-glucuronosyltransferase 2C1; UDPGT 2C1; Fragment |
UniProt ID | P36514 |
◆ Recombinant Proteins | ||
PCGF6-12493M | Recombinant Mouse PCGF6 Protein | +Inquiry |
RFL25220OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Chloroplast Envelope Membrane Protein(Cema) Protein, His-Tagged | +Inquiry |
ANAPC2-8197Z | Recombinant Zebrafish ANAPC2 | +Inquiry |
CAST-1149R | Recombinant Rat CAST Protein | +Inquiry |
MYDGF-537H | Recombinant Human MYDGF Protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1757C | Active Native Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
CRP-8057H | Native C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C16orf48-8255HCL | Recombinant Human C16orf48 293 Cell Lysate | +Inquiry |
ZFP90-1978HCL | Recombinant Human ZFP90 cell lysate | +Inquiry |
TIPRL-1058HCL | Recombinant Human TIPRL 293 Cell Lysate | +Inquiry |
LRRC48-4627HCL | Recombinant Human LRRC48 293 Cell Lysate | +Inquiry |
KLK13-2899HCL | Recombinant Human KLK13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT2C1 Products
Required fields are marked with *
My Review for All UGT2C1 Products
Required fields are marked with *
0
Inquiry Basket