Recombinant Full Length Putative Zinc Metalloprotease Xf_1047(Xf_1047) Protein, His-Tagged
Cat.No. : | RFL20590XF |
Product Overview : | Recombinant Full Length Putative zinc metalloprotease XF_1047(XF_1047) Protein (Q9PEI1) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xylella fastidiosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MGDFFASIWWMIVSFSVLVTFHEFGHYWVARRCGVKVLRFSIGFGTPLWSRRSSSGTEFV IGAIPLGGYVKMLDEREADVTVAERNQAFNRKSVWQRIAIVAAGPLANLLLCMLLLWVLF VIGKQDYSATVGRAEHLAAQAGIHPGDRITAIDGRQVTSWSEASMLLTAAAMDRQNAVLR VIGPYGERSEHTLELSKLKQPFDERHVTALVGINWQFMLQPPIIAKIEPGSIAEGAIKPG DIVLAVDGQQTLSTEDLYNQIQKLGRDGHPGMIEIRRGEERLALELSPRKSAQGVWLLGV KTNPGPVPAFDSQQRYGVLAAVPLAIRETGRMTADSLGMMKRIITGQASAKNISGPISIA KIANASAKRGVGWFIYFLSLLSLSLAIINLFPIPILDGGHLLYYAIELLKGSPLSTRAMA AGQYIGLALLAGLMGLAFYNDLLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | XF_1047 |
Synonyms | XF_1047; Putative zinc metalloprotease XF_1047 |
UniProt ID | Q9PEI1 |
◆ Recombinant Proteins | ||
TPMT.1-690Z | Recombinant Zebrafish TPMT.1 | +Inquiry |
ADAMTS1-531H | Recombinant Human ADAMTS1, His-tagged | +Inquiry |
NEUROD1-8614Z | Recombinant Zebrafish NEUROD1 | +Inquiry |
PPP3CB-2226C | Recombinant Chicken PPP3CB | +Inquiry |
CDA-3108HF | Recombinant Full Length Human CDA Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-03C | Native Cynomolgus Monkey ALB protein | +Inquiry |
Immunoglobulin A1-77H | Native Human Immunoglobulin A1 | +Inquiry |
IgG-009H | Native Hamster Whole Molecule IgG, Biotin Conjugate | +Inquiry |
CVB6-14 | Native Coxsackievirus B6 Antigen | +Inquiry |
PTI-29B | Active Native Bovine Aprotinin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR1-736HCL | Recombinant Human GPR1 cell lysate | +Inquiry |
CRISP2-7279HCL | Recombinant Human CRISP2 293 Cell Lysate | +Inquiry |
ARF4-8758HCL | Recombinant Human ARF4 293 Cell Lysate | +Inquiry |
ICA1L-5314HCL | Recombinant Human ICA1L 293 Cell Lysate | +Inquiry |
KDR-1769HCL | Recombinant Human KDR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XF_1047 Products
Required fields are marked with *
My Review for All XF_1047 Products
Required fields are marked with *
0
Inquiry Basket