Recombinant Full Length Putative Zinc Metalloprotease Ml1582(Ml1582) Protein, His-Tagged
Cat.No. : | RFL17434MF |
Product Overview : | Recombinant Full Length Putative zinc metalloprotease ML1582(ML1582) Protein (Q9CBU4) (1-404aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium leprae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-404) |
Form : | Lyophilized powder |
AA Sequence : | MMFALGIVLFAIAILISVALHECGHLWVACATGMKVRRYFVGFGPTLWSTRRGETQYGIK AVPLGGFCDIVGMTSVEKLEPDESDRAMYKQATWKRVAVLFAGPAMNFVICLVLIYGIAL VWGLPNLHMPTRAVIGETACVASELDQGKLGNCTGPGPAALAGLRAGDVVVKIGDTTVST FDDMAAVVRKLHGTVPIVFERDGTAITSYVDITPTQRYMSKGKGSQLEPATVGAIGVGAH HLLPTHYGVFSALPATAAFAGDLTVEVGKALVTIPTKLGALVHAIGGGQRDPQTPMSVVG ASIIGGDTVDHGLWVAFWFFLAQLNLILGAINLVPLLPFDGGHIAIAVFERIRNLIRSAR GVVVAAPVNYLKLMPATYVVLVFVVGYVLLTVTADLVNPIRLFQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rip1 |
Synonyms | rip1; ML1582; Zinc metalloprotease Rip1; S2P endopeptidase; Site-2 protease Rip1; S2P protease Rip1; Site-2-type intramembrane protease |
UniProt ID | Q9CBU4 |
◆ Recombinant Proteins | ||
FOXP2-1567R | Recombinant Rhesus Macaque FOXP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dtnbp1-683R | Recombinant Rat Dtnbp1 Protein, His-tagged | +Inquiry |
LTF-6210HF | Recombinant Full Length Human LTF Protein, GST-tagged | +Inquiry |
Zeb2-1648M | Recombinant Mouse Zeb2 protein, His & T7-tagged | +Inquiry |
MYLIP-5849M | Recombinant Mouse MYLIP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1804L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 649 labeled | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
ALB-524H | Native Human ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTBD6-8396HCL | Recombinant Human BTBD6 293 Cell Lysate | +Inquiry |
POP5-3010HCL | Recombinant Human POP5 293 Cell Lysate | +Inquiry |
RPL32-2205HCL | Recombinant Human RPL32 293 Cell Lysate | +Inquiry |
ZNF137P-1988HCL | Recombinant Human ZNF137P cell lysate | +Inquiry |
HDAC11-5606HCL | Recombinant Human HDAC11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rip1 Products
Required fields are marked with *
My Review for All rip1 Products
Required fields are marked with *
0
Inquiry Basket