Recombinant Full Length Putative Udp-Glucuronosyltransferase Ugt-50(Ugt-50) Protein, His-Tagged
Cat.No. : | RFL2360CF |
Product Overview : | Recombinant Full Length Putative UDP-glucuronosyltransferase ugt-50(ugt-50) Protein (Q22295) (26-523aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (26-523) |
Form : | Lyophilized powder |
AA Sequence : | AKILVYCPSISKSHVLLCSKYADLLHNAGHDTVLFIPSYSKLLDNYDGAKHAKVWRLHNV TEAYDTKLGTLANVMENSHIGFIDRLTFDADFWIDMCADLLGKLPEMQHIIDYKFDLVIY NEIDPCTPAIVRLFNIPKTVLLSSEAIMDKVAWNLGLPTLPSYVPSVEENPNHDRMSFFE RMSNVYKFFQSIVVHYLQDIHVLNLFRKEVSSDFPSIAEIIRNVSLVLVNTDEIFDLPRS YSSKFVYVGMLEAGKDENVTLPKKQDDYFKKGKSGSVFVSFGTVTPFRSLPERIQLSILN AIQKLPDYHFVVKTTADDESSAQFFSTVQNVDLVDWVPQKAVLRHANLKLFVSHGGMNSV LETMYYGVPMVIMPVFTDQFRNGRNVERRGAGKMVLRETVVKETFFDAIHSVLEEKSYSS SVKRISHLMKNKPFTSEERVTKWIDFVLKYETSEHFDLESNNLSIIEHNHLDLFFYLCII SLLNFVVYRKIFKRKSQS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ugt-50 |
Synonyms | ugt-50; ugt16; T07C5.1; Putative UDP-glucuronosyltransferase ugt-50; UDPGT 50 |
UniProt ID | Q22295 |
◆ Recombinant Proteins | ||
NBEA-10446M | Recombinant Mouse NBEA Protein | +Inquiry |
Tgfb1-527G | Recombinant Guinea pig Tgfb1 protein, His & S-tagged | +Inquiry |
Tgfbr3-297M | Recombinant Mouse Tgfbr3 Protein, His/GST-tagged | +Inquiry |
MOB3B-2620R | Recombinant Rhesus Macaque MOB3B Protein, His (Fc)-Avi-tagged | +Inquiry |
TAF1C-5915R | Recombinant Rat TAF1C Protein | +Inquiry |
◆ Native Proteins | ||
AZU1-26565TH | Native Human AZU1 | +Inquiry |
SLC40A1-5335H | Native Human Solute Carrier Family 40 (iron-regulated transporter), Member 1 | +Inquiry |
IgG-123G | Native Guinea pig Immunoglobulin G | +Inquiry |
FDP-X-51H | Native Human Fibrinogen Degrading Product-X | +Inquiry |
MMP1-45H | Native Human MMP-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLH3-4294HCL | Recombinant Human MLH3 293 Cell Lysate | +Inquiry |
TTC9C-672HCL | Recombinant Human TTC9C 293 Cell Lysate | +Inquiry |
Fetal Skin-162H | Human Fetal Skin Lysate | +Inquiry |
HAVCR2-995MCL | Recombinant Mouse HAVCR2 cell lysate | +Inquiry |
UBR3-2068HCL | Recombinant Human UBR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ugt-50 Products
Required fields are marked with *
My Review for All ugt-50 Products
Required fields are marked with *
0
Inquiry Basket