Recombinant Full Length Putative Udp-Glucuronosyltransferase Ugt-47(Ugt-47) Protein, His-Tagged
Cat.No. : | RFL25662CF |
Product Overview : | Recombinant Full Length Putative UDP-glucuronosyltransferase ugt-47(ugt-47) Protein (A8WLF6) (22-536aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis briggsae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-536) |
Form : | Lyophilized powder |
AA Sequence : | YNILVFSPATSKSHLISNGRIADELARAGHNVTLLEIDFLGIVDTTKSAKLVKKTIVRTP KGMQGFRNVLQGFSEIVMEDPGLWGLVEGNIMYQNAYNALCEEFLEMDDIFQELKAQNFD GFFAEQLNICGFGYAKALGIERRFLISSCPYFSHVYDYTSHPAPYASVPFVADMSPEPTY FERAQNLLNGFTCNMLFRYMHTRLSFIFRNKFGQDFPSVPEIVRNADIIFLATDEIIDFS APTLPNLVNIGGLGVDDDTTEMEPVFEAEMKKGEKGVILFSLGTIANTSTIDKKVMESFL GIVKKFPDYHFLIRADKYDKNTKERAKGISNVFVSDWLPQPAILHHPRLRTFITHAGYNG LVEAARAGVPLITIPFMFDQNLNSRAIEKKGWGIRSDKKKLLNDPDSFEADLKEMLTNPS YTKNAHRIRDLIKSKPLGARDRFIKTTEWVIQNGGVRELLTEGRDLSIISSYNLDIIVPV LFVLLYCLIIPFFKLIGGFYYYSCFGHIESKHKLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ugt-47 |
Synonyms | ugt-47; CBG24767; Putative UDP-glucuronosyltransferase ugt-47; UDPGT 47 |
UniProt ID | A8WLF6 |
◆ Recombinant Proteins | ||
SPEF2-5699R | Recombinant Rat SPEF2 Protein | +Inquiry |
SLFN11-3503H | Recombinant Human SLFN11 protein, His-tagged | +Inquiry |
RFL24454AF | Recombinant Full Length Avian Metapneumovirus Major Surface Glycoprotein G(G) Protein, His-Tagged | +Inquiry |
CCNA2-0648H | Recombinant Human CCNA2 Protein, GST-Tagged | +Inquiry |
PLSC-1596E | Recombinant Escherichia coli PLSC Protein (1-245 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH4-23H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
Collagen-316B | Native Bovine Collagen Type II | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
Y. enterocolitica-31 | Native Yersinia enterocolitica O:9 Antigen | +Inquiry |
HGB-144G | Native Guinea Pig Hemoglobin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLCO1B1-1689HCL | Recombinant Human SLCO1B1 293 Cell Lysate | +Inquiry |
HDAC11-5606HCL | Recombinant Human HDAC11 293 Cell Lysate | +Inquiry |
Adipose-2H | Human Adipose Cytoplasmic Lysate | +Inquiry |
HSD17B7-819HCL | Recombinant Human HSD17B7 cell lysate | +Inquiry |
ABCF3-9143HCL | Recombinant Human ABCF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ugt-47 Products
Required fields are marked with *
My Review for All ugt-47 Products
Required fields are marked with *
0
Inquiry Basket