Recombinant Full Length Putative Neuropeptide Y Receptor 11(Npr-11) Protein, His-Tagged
Cat.No. : | RFL9768CF |
Product Overview : | Recombinant Full Length Putative neuropeptide Y receptor 11(npr-11) Protein (Q18179) (1-455aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-455) |
Form : | Lyophilized powder |
AA Sequence : | MGSVNESCDNYVEIFNKINYFFRDDQVINGTEYSPKEFGYFITFAYMLIILFGAIGNFLT IIVVILNPAMRTTRNFFILNLALSDFFVCIVTAPTTLYTVLYMFWPFSRTLCKIAGSLQG FNIFLSTFSIASIAVDRYVLIIFPTKRERQQNLSFCFFIMIWVISLILAVPLLQASDLTP VFVEPSCDLALYICHEQNEIWEKMIISKGTYTLAVLITQYAFPLFSLVFAYSRIAHRMKL RFANRNQNVTTNTNTSQRRRSVVERQRRTHLLLVCVVAVFAVAWLPLNVFHIFNTFELVN SFSVTTFSICHCLAMCSACLNPLIYAFFNHNFRIEFMHLFDRVGLRSLRVVIFGEQESLK KSMRTEFRSRGGCKTVTTAEPATFQRMNESMILSAMEQDEQLSSGGKLFVLKKYILKMFQ KGGHKQSTPASPRLGFGYNSIMTSELFSIVEGVLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | npr-11 |
Synonyms | npr-11; C25G6.5; Putative neuropeptide Y receptor 11; NPY-R |
UniProt ID | Q18179 |
◆ Recombinant Proteins | ||
FUNDC1-442H | Recombinant Human FUNDC1 | +Inquiry |
SNX2-954C | Recombinant Cynomolgus SNX2 Protein, His-tagged | +Inquiry |
DUSP13-5628H | Recombinant Human DUSP13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCDC92-3136H | Recombinant Human CCDC92 protein, His-tagged | +Inquiry |
RFL32834ZF | Recombinant Full Length Zelotomys Hildegardeae Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
Plasminogen-87H | Native Human Plasminogen | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
APOB-26875TH | Native Human APOB | +Inquiry |
HP-200H | Native Human Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SALL1-2075HCL | Recombinant Human SALL1 293 Cell Lysate | +Inquiry |
THEM4-1775HCL | Recombinant Human THEM4 cell lysate | +Inquiry |
ARL6IP4-123HCL | Recombinant Human ARL6IP4 cell lysate | +Inquiry |
PDCD1LG2-1738MCL | Recombinant Mouse PDCD1LG2 cell lysate | +Inquiry |
AKR1B10-8931HCL | Recombinant Human AKR1B10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All npr-11 Products
Required fields are marked with *
My Review for All npr-11 Products
Required fields are marked with *
0
Inquiry Basket