Recombinant Full Length Putative Membrane Protein Igaa Homolog(Yrff) Protein, His-Tagged
Cat.No. : | RFL707SF |
Product Overview : | Recombinant Full Length Putative membrane protein igaA homolog(yrfF) Protein (P58721) (1-710aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-710) |
Form : | Lyophilized powder |
AA Sequence : | MSTILIFIAALLACSLLAIWRFRVKSRRGSLPWFSAFQDAQTRKLLPEERSAVENYLDNL SQIQQVPGPTGASAAPISLTLNAESNSVVILTHSITRYGITTDDPNKWRYYLDSVEVHLP PFWEQYINDENNVELILTDTLPLVISLNGHTLQEYMQESRGYALQNTASTQASIRGEESE QIELLNIRQETHEEYALSRPAGLREALLIVASFLLFFFCLITPDVFVPWMIGGAILLLAA GLWGLFAPPSKSALREIHCLRGTPRRWGLFGENNQEQINNISLGIIDLIYPAHWQPYITQ DLGQQTDIDIYLDRHVARQGRFLSLHDEVKNFPLQHWLRSTVIAIGSLLVLFMLLFWIPL DMPIKFTLSWMKGAQTIEATTVKQLEKAGVRVGDTLHLSGKGMCNIHSGATWSGQSNSPF MPFDCSQIIWNDAPALPLPESDLVNKAMALSQAVNRQLHPKPEDDSRVSASLRSAIQKSG MVLLDDFGDIVLKTADLCAAEDECVRLKNALVNLGNSKDWNALVKRANAGKLDGVNVLLR PVSAESLENLVTTSTAPFISRETARAAQSLNSPAPGGFLIASDEGSELVDQAWPSTPLYD YPAQEQWSAFQRLAQTLMQTPFSAEGIVTSVYTDANGTQHISLHRIPDKSGWWRYLGTTL LMLAMIVSAVYNGIQAFRRYQRHRTRMADIQEYYESCLNPRLTVSPENLI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yrfF |
Synonyms | yrfF; STY4301; t4011; Putative membrane protein IgaA homolog |
UniProt ID | P58721 |
◆ Recombinant Proteins | ||
RFL8618AF | Recombinant Full Length Azotobacter Vinelandii Electron Transport Complex Protein Rnfe(Rnfe) Protein, His-Tagged | +Inquiry |
RFL35523MF | Recombinant Full Length Macaca Maura Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged | +Inquiry |
TRDMT1-28370TH | Recombinant Human TRDMT1 | +Inquiry |
GNA15-7013M | Recombinant Mouse GNA15 Protein | +Inquiry |
RBBP6-1160Z | Recombinant Zebrafish RBBP6 | +Inquiry |
◆ Native Proteins | ||
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
LHB-8212H | Native Luteinizing Beta Subunit Hormone | +Inquiry |
Prothrombin-93H | Native Human Prothrombin | +Inquiry |
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGR1-6692HCL | Recombinant Human EGR1 293 Cell Lysate | +Inquiry |
VSTM2A-377HCL | Recombinant Human VSTM2A 293 Cell Lysate | +Inquiry |
Cecum-487C | Chicken Cecum Lysate, Total Protein | +Inquiry |
UBE2I-573HCL | Recombinant Human UBE2I 293 Cell Lysate | +Inquiry |
Aorta-717P | Pig Aorta Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yrfF Products
Required fields are marked with *
My Review for All yrfF Products
Required fields are marked with *
0
Inquiry Basket