Recombinant Full Length Putative Glycosyltransferases(Pimf) Protein, His-Tagged
Cat.No. : | RFL23525HF |
Product Overview : | Recombinant Full Length Putative glycosyltransferases(pimF) Protein (P71781) (1-342aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-342) |
Form : | Lyophilized powder |
AA Sequence : | MRLSIVTTMYMSEPYVLEFYRRARAAADKITPDVEIIFVDDGSPDAALQQAVSLLDSDPC VRVIQLSRNFGHHKAMMTGLAHATGDLVFLIDSDLEEDPALLEPFYEKLISTGADVVFGC HARRPGGWLRNFGPKIHYRASALLCDPPLHENTLTVRLMTADYVRSLVQHQERELSIAGL WQITGFYQVPMSVNKAWKGTTTYTFRRKVATLVDNVTSFSNKPLVFIFYLGAAIFIISSS AAGYLIIDRIFFRALQAGWASVIVSIWMLGGVTIFCIGLVGIYVSKVFIETKQRPYTIIR RIYGSDLTTREPSSLKTAFPAAHLSNGKRVTSEPEGLATGNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Putative glycosyltransferases(pimF) |
UniProt ID | P71781 |
◆ Native Proteins | ||
AGT-152H | Native Human Angiotensinogen | +Inquiry |
Apotransferrin-36M | Native Mouse Apotransferrin | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
◆ Cell & Tissue Lysates | ||
BOP1-8418HCL | Recombinant Human BOP1 293 Cell Lysate | +Inquiry |
TNS4-1805HCL | Recombinant Human TNS4 cell lysate | +Inquiry |
PITX2-3165HCL | Recombinant Human PITX2 293 Cell Lysate | +Inquiry |
CD200R1L-2289HCL | Recombinant Human CD200R1L cell lysate | +Inquiry |
COL6A5-646HCL | Recombinant Human COL6A5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Putative glycosyltransferases(pimF) Products
Required fields are marked with *
My Review for All Putative glycosyltransferases(pimF) Products
Required fields are marked with *
0
Inquiry Basket