Recombinant Full Length Putative Fatty-Acid--Coa Ligase Fadd11(Fadd11) Protein, His-Tagged
Cat.No. : | RFL8843HF |
Product Overview : | Recombinant Full Length Putative fatty-acid--CoA ligase fadD11(fadD11) Protein (Q10776) (1-571aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-571) |
Form : | Lyophilized powder |
AA Sequence : | MARLRGAGAAGRCRPGRFGSSARRHGLADDGEPDRVLPARRRCSARRRHLVFGVQHPARR AADLRVRQRGDQGGHLRATVRRSRSRQRCAHRTHRLRRWRAPGTLSLTDLYAAASGDFFD FESTWRAVQPEDIVTLIYTSGTTGNPKGVEMTHANLLFEGYAIDEVLGIRFGDRVTSFLP SAHIADRMTGLYLQEMFGTQVTAVADARTIAAALPDVRPTVWGAVPRVWEKLKAGIEFTV ARETDEMKRQALAWAMSVAGKRANALLAGESMSDQLVAEWAKADELVLSKLRERLGFGEL RWALSGAAPIPKETLAFFAGIGIPIAEIWGMSELSCVATASHPRDGRLGTVGKLLPGLQG KIAEDGEYLVRGPLVMKGYRKEPAKTAEAIDSDGWLHTGDVFDIDSDGYLRVVDRKKELI INAAGKNMSPANIENTILAACPMVGVMMAIGDGRTYNTALLVFDADSLGPYAAQRGLDAS PAALAADPEVIARIAAGVAEGNAKLSRVEQIKRFRILPTLWEPGGDEITLTMKLKRRRIA AKYSAEIEELYASELRPQVYEPAAVPSTQPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Putative fatty-acid--CoA ligase fadD11(fadD11) |
UniProt ID | Q10776 |
◆ Recombinant Proteins | ||
CBX7-2797M | Recombinant Mouse CBX7 Protein | +Inquiry |
CHCHD3B-5491Z | Recombinant Zebrafish CHCHD3B | +Inquiry |
IL4RA-0295C | Active Recombinant Cynomolgus / Rhesus macaque IL4RA protein, His-tagged | +Inquiry |
Prl-001M | Recombinant Mouse Prolactin / Prl Protein | +Inquiry |
NRAS-1922C | Recombinant Chicken NRAS | +Inquiry |
◆ Native Proteins | ||
APOB-26875TH | Native Human APOB | +Inquiry |
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
LDH-226H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SF3B14-1918HCL | Recombinant Human SF3B14 293 Cell Lysate | +Inquiry |
ZNF92-2093HCL | Recombinant Human ZNF92 cell lysate | +Inquiry |
LGALS7B-4764HCL | Recombinant Human LGALS7B 293 Cell Lysate | +Inquiry |
RBCK1-2487HCL | Recombinant Human RBCK1 293 Cell Lysate | +Inquiry |
GAD1-586HCL | Recombinant Human GAD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Putative fatty-acid--CoA ligase fadD11(fadD11) Products
Required fields are marked with *
My Review for All Putative fatty-acid--CoA ligase fadD11(fadD11) Products
Required fields are marked with *
0
Inquiry Basket