Recombinant Full Length Putative Cytochrome P450 141(Cyp141) Protein, His-Tagged
Cat.No. : | RFL30160HF |
Product Overview : | Recombinant Full Length Putative cytochrome P450 141(cyp141) Protein (O08362) (1-400aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-400) |
Form : | Lyophilized powder |
AA Sequence : | MTSTSIPTFPFDRPVPTEPSPMLSELRNSCPVAPIELPSGHTAWLVTRFDDVKGVLSDKR FSCRAAAHPSSPPFVPFVQLCPSLLSIDGPQHTAARRLLAQGLNPGFIARMRPVVQQIVD NALDDLAAAEPPVDFQEIVSVPIGEQLMAKLLGVEPKTVHELAAHVDAAMSVCEIGDEEV SRRWSALCTMVIDILHRKLAEPGDDLLSTIAQANRQQSTMTDEQVVGMLLTVVIGGVDTP IAVITNGLASLLHHRDQYERLVEDPGRVARAVEEIVRFNPATEIEHLRVVTEDVVIAGTA LSAGSPAFTSITSANRDSDQFLDPDEFDVERNPNEHIAFGYGPHACPASAYSRMCLTTFF TSLTQRFPQLQLARPFEDLERRGKGLHSVGIKELLVTWPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Putative cytochrome P450 141(cyp141) |
UniProt ID | O08362 |
◆ Recombinant Proteins | ||
UGP2-788HFL | Recombinant Full Length Human UGP2 Protein, C-Flag-tagged | +Inquiry |
PEX5L-3378R | Recombinant Rhesus monkey PEX5L Protein, His-tagged | +Inquiry |
AOX1-329H | Recombinant Human AOX1 Protein (236-421 aa), His-tagged | +Inquiry |
Tnni3-2674M | Recombinant Mouse Tnni3 protein, His-tagged | +Inquiry |
RFL19205EF | Recombinant Full Length Escherichia Coli Putative Lipoprotein Ylif(Ylif) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ATF-24B | Native Bovine Bovine Apo Transferrin | +Inquiry |
LOC102577615-59P | Native potato LOC102577615 Protein | +Inquiry |
IgG-020S | Native Sheep Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-1817P | Active Native Peanut Lectin Protein, Rhodamine labeled | +Inquiry |
ALB-115C | Native Chicken Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEP76-180HCL | Recombinant Human CEP76 lysate | +Inquiry |
LRIG1-1828MCL | Recombinant Mouse LRIG1 cell lysate | +Inquiry |
PGLYRP1-1339HCL | Recombinant Human PGLYRP1 cell lysate | +Inquiry |
AIF1-8956HCL | Recombinant Human AIF1 293 Cell Lysate | +Inquiry |
IFNW1-2929HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Putative cytochrome P450 141(cyp141) Products
Required fields are marked with *
My Review for All Putative cytochrome P450 141(cyp141) Products
Required fields are marked with *
0
Inquiry Basket